[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : fdnH
DDBJ      :fdnH         formate dehydrogenase, nitrate-inducible, iron-sulfur subunit
Swiss-Prot:FDNH_SHIFL   RecName: Full=Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit;AltName: Full=Formate dehydrogenase-N subunit beta;         Short=FDH-N subunit beta;AltName: Full=Anaerobic formate dehydrogenase iron-sulfur subunit;

Homologs  Archaea  52/68 : Bacteria  491/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.58.1f.23.22
:294 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->283 1kqfB PDBj e-166 93.3 %
:RPS:PDB   95->197 1a6lA PDBj 6e-15 16.8 %
:RPS:SCOP  2->245 1kqfB1  d.58.1.5 * 2e-98 93.4 %
:RPS:SCOP  246->283 1kqfB2  f.23.22.1 * 2e-14 92.1 %
:HMM:SCOP  24->251 1q16B_ d.58.1.5 * 5.4e-71 33.5 %
:HMM:SCOP  246->290 1kqfB2 f.23.22.1 * 1.9e-12 42.9 %
:RPS:PFM   246->283 PF09163 * Form-deh_trans 1e-11 68.4 %
:HMM:PFM   246->289 PF09163 * Form-deh_trans 1.5e-21 43.2 44/44  
:HMM:PFM   34->49 PF00037 * Fer4 3e-05 50.0 16/24  
:HMM:PFM   130->147 PF00037 * Fer4 6.3e-08 50.0 18/24  
:HMM:PFM   174->184 PF00037 * Fer4 9.2e-05 72.7 11/24  
:BLT:SWISS 1->283 FDNH_SHIFL e-166 93.3 %
:PROS 133->144|PS00198|4FE4S_FER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66076.1 GT:GENE fdnH GT:PRODUCT formate dehydrogenase, nitrate-inducible, iron-sulfur subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1698394..1699278) GB:FROM 1698394 GB:TO 1699278 GB:DIRECTION - GB:GENE fdnH GB:PRODUCT formate dehydrogenase, nitrate-inducible, iron-sulfur subunit GB:NOTE identified by match to protein family HMM PF00037; match to protein family HMM PF09163; match to protein family HMM TIGR01582 GB:PROTEIN_ID ACF66076.1 GB:DB_XREF GI:194405857 GB:GENE:GENE fdnH LENGTH 294 SQ:AASEQ MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEHAGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKETDDDEEDHHE GT:EXON 1|1-294:0| SW:ID FDNH_SHIFL SW:DE RecName: Full=Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit;AltName: Full=Formate dehydrogenase-N subunit beta; Short=FDH-N subunit beta;AltName: Full=Anaerobic formate dehydrogenase iron-sulfur subunit; SW:GN Name=fdnH; OrderedLocusNames=SF1750, S1883; SW:KW 4Fe-4S; Cell membrane; Complete proteome; Electron transport; Iron;Iron-sulfur; Membrane; Metal-binding; Repeat; Transmembrane;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->283|FDNH_SHIFL|e-166|93.3|283/294| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 133->144|PS00198|4FE4S_FER_1|PDOC00176| TM:NTM 1 TM:REGION 257->279| SEG 284->293|etdddeedhh| BL:PDB:NREP 1 BL:PDB:REP 2->283|1kqfB|e-166|93.3|282/289| RP:PDB:NREP 1 RP:PDB:REP 95->197|1a6lA|6e-15|16.8|101/106| RP:PFM:NREP 1 RP:PFM:REP 246->283|PF09163|1e-11|68.4|38/44|Form-deh_trans| HM:PFM:NREP 4 HM:PFM:REP 246->289|PF09163|1.5e-21|43.2|44/44|Form-deh_trans| HM:PFM:REP 34->49|PF00037|3e-05|50.0|16/24|Fer4| HM:PFM:REP 130->147|PF00037|6.3e-08|50.0|18/24|Fer4| HM:PFM:REP 174->184|PF00037|9.2e-05|72.7|11/24|Fer4| RP:SCP:NREP 2 RP:SCP:REP 2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5| RP:SCP:REP 246->283|1kqfB2|2e-14|92.1|38/45|f.23.22.1| HM:SCP:REP 24->251|1q16B_|5.4e-71|33.5|227/509|d.58.1.5|1/1|4Fe-4S ferredoxins| HM:SCP:REP 246->290|1kqfB2|1.9e-12|42.9|42/45|f.23.22.1|1/1|Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor| OP:NHOMO 2283 OP:NHOMOORG 547 OP:PATTERN 22121222344333324-5563373113-1-21-133122122-1--11-1-1121-5252---4--- -6811111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------5bS334222-----------------1--1----------------2243333332334411333-3----------------------------------------1-1----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------132--1111111-1-1411-111--1--9--13ni3354-49A1113----721--1------21--323-21--11111111112-1131131311----------1-1121-11212-1--312111111113----8-4-----------------------------------122-3211212233333323444413222334211232241443325213124---23----------B34-7E648CC7C999E188686683-A9A9343827322112211-2-------2A3321153-111-----46997-5H9A9787C98K8----732------A5C898-EFFEEEDDEE-EEDFEEEEDEFEECEEEE79997621AFDEEFFFFFFEDFDEE6989CBCD--455555555454---1---------1112-444434133232114-------1-12-22221-1--11114-------------2333111114422322------------123---------------------------------------------1--1-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 95.9 SQ:SECSTR #ccTTccEEEETTccTTccccccHHHHHHHHHEEccGGGGcccccHHcccTHHTcTTcTTcccTTcccccccccccccccccHHHTcccHHHHHEEcGGGTTTcccHHHHHcTTTccEEEccccEEEcTTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGGGHHHHHccccTcTTcEEEccGGGTcccEEEEETTTTcGGGTTTccccccccHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHcccc########### DISOP:02AL 1-26,282-295| PSIPRED ccccccccccccccccccccccccccccEEEEEEEHHHcccccHHHHHHHHHHccccccccccccEEccccccccccEEEEEEEccccccEEEEEEcccccccccHHHHHHcccccEEEEcccccEEEccccccccccHHHccccccEEEEccccEEEEccccHHHHHccccccHHHHcccccEEEEcHHHHHHHHHHHHHHHHHccccccEEcccccccccEEEEEEcccccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //