[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : fhuA
DDBJ      :fhuA         ferrichrome-iron receptor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  358/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.4.3
:747 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->747 2grxA PDBj 0.0 88.2 %
:RPS:PDB   51->747 1by5A PDBj 1e-94 86.5 %
:RPS:SCOP  71->747 1by3A  f.4.3.3 * 1e-94 88.0 %
:HMM:SCOP  51->747 1by5A_ f.4.3.3 * 3.1e-144 27.4 %
:RPS:PFM   80->181 PF07715 * Plug 4e-10 37.5 %
:HMM:PFM   510->746 PF00593 * TonB_dep_Rec 5.5e-31 19.7 233/277  
:HMM:PFM   76->180 PF07715 * Plug 5e-24 34.0 103/108  
:BLT:SWISS 1->747 FHUA_ECOLI 0.0 88.1 %
:PROS 1->47|PS00430|TONB_DEPENDENT_REC_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68652.1 GT:GENE fhuA GT:PRODUCT ferrichrome-iron receptor GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 231422..233665 GB:FROM 231422 GB:TO 233665 GB:DIRECTION + GB:GENE fhuA GB:PRODUCT ferrichrome-iron receptor GB:NOTE identified by match to protein family HMM PF00593; match to protein family HMM PF07715; match to protein family HMM TIGR01783 GB:PROTEIN_ID ACF68652.1 GB:DB_XREF GI:194408433 GB:GENE:GENE fhuA LENGTH 747 SQ:AASEQ MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVTAAPAAQESAWGPAATIAARQSATATKTDTPIQKVPQPISVVTAEEMALHQPKSVKEALSYTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAEVMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEIQFKMGTDSLFQTGFDFSDALDEEGVYSYRLTGLARSANAQQDRAEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDIFTVRQNLRYAENKVSQNSVYGYGVCSDPANGYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGEVDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVYTDFDFASRDPATSGPYQILNKQKQTGLYVQDQAQWDKVLVTLGGRYDWADQESLNRTTGITSKRDDKQFTWRGGVNYLFDNGITPYFSYSESFEPASQTGENGKIFAPSKGKQYEAGVKYVPNDRPIVITGAVYQLTKTNNLMADPAGSFFSVEGGEIRARGVELEAKAALSASINVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWGDYTFFDGPLSGLTLGTGGRFTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFQTYGCFWGAERQVVATATFRF GT:EXON 1|1-747:0| BL:SWS:NREP 1 BL:SWS:REP 1->747|FHUA_ECOLI|0.0|88.1|747/747| PROS 1->47|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| SEG 58->70|aatiaarqsatat| SEG 621->634|ytytdaeyttdtty| SEG 658->675|gplsgltlgtggrftgss| BL:PDB:NREP 1 BL:PDB:REP 41->747|2grxA|0.0|88.2|702/702| RP:PDB:NREP 1 RP:PDB:REP 51->747|1by5A|1e-94|86.5|697/697| RP:PFM:NREP 1 RP:PFM:REP 80->181|PF07715|4e-10|37.5|96/108|Plug| HM:PFM:NREP 2 HM:PFM:REP 510->746|PF00593|5.5e-31|19.7|233/277|TonB_dep_Rec| HM:PFM:REP 76->180|PF07715|5e-24|34.0|103/108|Plug| GO:PFM:NREP 4 GO:PFM GO:0004872|"GO:receptor activity"|PF07715|IPR012910| GO:PFM GO:0005215|"GO:transporter activity"|PF07715|IPR012910| GO:PFM GO:0006810|"GO:transport"|PF07715|IPR012910| GO:PFM GO:0016020|"GO:membrane"|PF07715|IPR012910| RP:SCP:NREP 1 RP:SCP:REP 71->747|1by3A|1e-94|88.0|677/695|f.4.3.3| HM:SCP:REP 51->747|1by5A_|3.1e-144|27.4|697/0|f.4.3.3|1/1|Porins| OP:NHOMO 1586 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- 2---------------------------------------------------------------------------------------22---1-----1-7211A-8-1----------------1-------22----------811311-----------23-B9J1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1333-----325346B3932A1----------3-BB2BA6DA1-3-6333112221237133---83155---66666666-3364-74------------------------------13G33397869ACDD9733337742555525B346477--44513543I11-A24F-162B111132312H532521-1---------------1--112--------E-43---112-----------2-----33-5133584-3769716167772415824---2--1------63521633335344322-323233322233221322244456121221122222221211261111111--322222222222--------------4145112112--1------989971C-12F9CDCECKCH7FTHE2BA8----------3323122123331-7B693973331111----11--11-----------------------------------------------8- --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------6-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 718 STR:RPRED 96.1 SQ:SECSTR #############################HHHHHHGGGEEEHHHHHHTcccccTTcccccccccEEcTTTcccEEGGGccccEEEEEHHHHHHHccccHHHHTTTcTTEEccTTTTcccccccEETTcccTTccccEEETTEEccccTTccccccGGGEEEEEEEEcccHHHHccccTTEEEEEEEcccccccEEEEEEEEETTTEEEEEEEEEEEccccccEEEEEEEEEEEEEcccTTcEEEEEEEEEEEEEcccTTEEEEEEEEEEEEEEccccccccccTTTcccTTcccccTTcccccTTcEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEEEETTcGGGTTcHHHHTccGGGGGcEEEEEEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEEEEcTTcEEEEEcccccccccccccccTTcEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEETTTccEEEEEEEEEEEEEEEEEccTTcEEEEEEEEEEEEccccccTTccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEcTTTTTcccTTcccEEEEEEEEEEccccTTTTEEEEEEEEEEccEEccTTcccEEccEEEEEEEEEEETTTTTcTTcEEEEEEEcTTccccEEEEEETTEEEEccccEEEEEEEEEc DISOP:02AL 1-13,37-40,43-43,45-45,51-52| PSIPRED ccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEccEEEEEEcccccHHHcccEEEEEcHHHHHHHccccHHHHHHHcccEEEEcccccccccEEEEEEEcccccEEEEEEccEEccccccccccccHHHHcEEEEEEcccccccccccccEEEEEEEcccccccEEEEEEEEEEcccEEEEEEEEEEEcccccEEEEEEEEEEccccccccccccEEEEEEEEEEEccccEEEEEEEEEEEccccccccEEEcccccccccccccccccccccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEcccccccccccccccEEEEEEEEEEccccEEEEEEEEEEEEccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEcccccEEEEEcccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEccccccccccccccccEEEEEEEEEEEcccccccEEEEEEEEEEEEEEccccccEEEccEEEEEEEEEEEccccccccEEEEEEEEccccccEEEEEEccccEEEcccEEEEEEEEEEc //