[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : fhuC
DDBJ      :fhuC         ferrichrome transport ATP-binding protein FhuC
Swiss-Prot:FHUC_ECOLI   RecName: Full=Iron(3+)-hydroxamate import ATP-binding protein fhuC;         EC=3.6.3.34;AltName: Full=Iron(III)-hydroxamate import ATP-binding protein fhuC;AltName: Full=Ferrichrome transport ATP-binding protein fhuC;AltName: Full=Ferric hydroxamate uptake protein C;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:265 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   27->235 3dhwC PDBj 4e-27 33.7 %
:RPS:PDB   16->236 3b5jA PDBj 6e-43 23.9 %
:RPS:SCOP  14->254 1b0uA  c.37.1.12 * 7e-39 31.2 %
:HMM:SCOP  14->230 1ii8.1 c.37.1.12 * 1.1e-64 34.6 %
:RPS:PFM   51->176 PF00005 * ABC_tran 2e-11 37.2 %
:HMM:PFM   51->176 PF00005 * ABC_tran 1.3e-22 34.8 115/118  
:HMM:PFM   147->208 PF02463 * SMC_N 2e-05 32.3 62/220  
:HMM:PFM   37->62 PF03193 * DUF258 0.00024 30.8 26/161  
:BLT:SWISS 1->265 FHUC_ECOLI e-142 92.1 %
:PROS 148->162|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67730.1 GT:GENE fhuC GT:PRODUCT ferrichrome transport ATP-binding protein FhuC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 233714..234511 GB:FROM 233714 GB:TO 234511 GB:DIRECTION + GB:GENE fhuC GB:PRODUCT ferrichrome transport ATP-binding protein FhuC GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF67730.1 GB:DB_XREF GI:194407511 GB:GENE:GENE fhuC LENGTH 265 SQ:AASEQ MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGHNGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRELVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALRGGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY GT:EXON 1|1-265:0| SW:ID FHUC_ECOLI SW:DE RecName: Full=Iron(3+)-hydroxamate import ATP-binding protein fhuC; EC=3.6.3.34;AltName: Full=Iron(III)-hydroxamate import ATP-binding protein fhuC;AltName: Full=Ferrichrome transport ATP-binding protein fhuC;AltName: Full=Ferric hydroxamate uptake protein C; SW:GN Name=fhuC; OrderedLocusNames=b0151, JW0147; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Ion transport; Iron; Iron transport; Membrane;Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->265|FHUC_ECOLI|e-142|92.1|265/265| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0006826|"GO:iron ion transport"|Iron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 148->162|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 27->235|3dhwC|4e-27|33.7|205/343| RP:PDB:NREP 1 RP:PDB:REP 16->236|3b5jA|6e-43|23.9|218/243| RP:PFM:NREP 1 RP:PFM:REP 51->176|PF00005|2e-11|37.2|121/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 51->176|PF00005|1.3e-22|34.8|115/118|ABC_tran| HM:PFM:REP 147->208|PF02463|2e-05|32.3|62/220|SMC_N| HM:PFM:REP 37->62|PF03193|0.00024|30.8|26/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 14->254|1b0uA|7e-39|31.2|237/258|c.37.1.12| HM:SCP:REP 14->230|1ii8.1|1.1e-64|34.6|214/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49451 OP:NHOMOORG 1174 OP:PATTERN UUKBPNJHTTURTPXMlHPOKNMSnRUghWhUH8EDFAGFFEDSVOVlMT*zf9PbSSUOOGLFY198 TZkM*dcfnnpZbVbTYKK-Ki99W*LLLLLOqnkpx***S*a*t**gvrlR**uQTgBB***m*o****fbWWW*bYZQ*gnA9D9BRRQL5OFJL--EFUJJGYIVPR8988989AACBBBBJTRJSZLNUTXRmxx**JJJ*auhnsddiddXYMJMMNIccdo***UEQHLJIGQHNHGjZcROli9dgv************************gpx**htqtvprv**UghjijgghhggghgWXVUX*bZW**VPVVbzySS**cVOXkgggiqptvvqyyuuptpqljqwproYYZYYYaZcZZYY*qqdcgvtwmj*u*********f*in***Zdcc*nkol*clTL**ohVZfmRbidmiNYabLfUSSNNOLKPcX***YTr****************-mp*jd*q***OB**************GIK**********TTTTTTTTyaeMShb*887665556578788877876777A85A6GCBGDD***********x*z*w********j********AN**s*ksnq******cnlMTIPlWKKKKKKKRRPeiiZy*VeZznZnsedmGcXZUWZgTXXWVYu*Y*GKINCFDDGFDAAA98AAA9FQCCGQPtsuOrUWLULpSWabWQWeVVVWWWdYZbb6-DKVSQ211112****d************-*************zz**zx*****llmtsqrrtttttrrtrrs*vrsyyxzY2************44LJ9C89BLMNLPI*n*aZaYWWHOSNMUQVfMPQOPHUIQVpYzzyyv***z**zzl***CDDBCDDCDKiqp*opppp*****NMPQORPMPMCCBC96PMJJGHHJ76666667*DWC8B6B-A8BAHBCBCC8BFEB7778WepRNo*ppmEZO 3466faG1jOBDUiTMJNFHUaOaVdULLBDCEOKL9LHIGIKEHFMLOUYThYNLTCEGGGG9C8B92BA7ADF7D2BDGEBB8I7A-RVCJKGJFFFFH8GONI8SemgVcPlaeGGFCMVJun8*C**o3jUzHJJ6dCKlXAPFG8YDA*EXUSqIf*HqPcBxYc*geVNGJFK*EGHLQ*ru*M**IH****a ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12| PSIPRED ccccccccccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHHcEEcccccccccccHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHcccEEEEEccccccEEEEEc //