[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : gcvA
DDBJ      :gcvA         glycine cleavage system transcriptional activator
Swiss-Prot:GCVA_ECOLI   RecName: Full=Glycine cleavage system transcriptional activator;AltName: Full=Gcv operon activator;

Homologs  Archaea  3/68 : Bacteria  622/915 : Eukaryota  9/199 : Viruses  1/175   --->[See Alignment]
a.4.5b.149.1c.94.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->269 3hhgG PDBj 3e-21 29.6 %
:RPS:PDB   1->200 1bi1A PDBj 4e-27 10.2 %
:RPS:SCOP  3->160 2p4wA1  a.4.5.64 * 2e-22 13.4 %
:RPS:SCOP  188->294 1tg7A1  b.149.1.1 * 3e-10 12.4 %
:HMM:SCOP  6->115 1b9mA1 a.4.5.8 * 4e-24 35.2 %
:HMM:SCOP  84->293 1uthA_ c.94.1.1 * 1.2e-42 27.8 %
:RPS:PFM   8->67 PF00126 * HTH_1 5e-11 51.7 %
:RPS:PFM   93->284 PF03466 * LysR_substrate 1e-12 36.8 %
:HMM:PFM   91->292 PF03466 * LysR_substrate 7.5e-45 26.5 200/209  
:HMM:PFM   8->67 PF00126 * HTH_1 4.1e-25 55.0 60/60  
:BLT:SWISS 1->305 GCVA_ECOLI e-172 98.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69763.1 GT:GENE gcvA GT:PRODUCT glycine cleavage system transcriptional activator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3116911..3117828) GB:FROM 3116911 GB:TO 3117828 GB:DIRECTION - GB:GENE gcvA GB:PRODUCT glycine cleavage system transcriptional activator GB:NOTE identified by match to protein family HMM PF00126; match to protein family HMM PF03466 GB:PROTEIN_ID ACF69763.1 GB:DB_XREF GI:194409544 GB:GENE:GENE gcvA LENGTH 305 SQ:AASEQ MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQARSAKGALTVSLPPSFAIQWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGEKPLKTPEDLAKHTLLHDASRRDWQAYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGIALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKAATEQEKFRFRYEQ GT:EXON 1|1-305:0| SW:ID GCVA_ECOLI SW:DE RecName: Full=Glycine cleavage system transcriptional activator;AltName: Full=Gcv operon activator; SW:GN Name=gcvA; OrderedLocusNames=b2808, JW2779; SW:KW Activator; Complete proteome; Cytoplasm; DNA-binding; Repressor;Transcription; Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->305|GCVA_ECOLI|e-172|98.4|305/305| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 11->269|3hhgG|3e-21|29.6|257/294| RP:PDB:NREP 1 RP:PDB:REP 1->200|1bi1A|4e-27|10.2|196/212| RP:PFM:NREP 2 RP:PFM:REP 8->67|PF00126|5e-11|51.7|60/60|HTH_1| RP:PFM:REP 93->284|PF03466|1e-12|36.8|185/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 91->292|PF03466|7.5e-45|26.5|200/209|LysR_substrate| HM:PFM:REP 8->67|PF00126|4.1e-25|55.0|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 3->160|2p4wA1|2e-22|13.4|157/194|a.4.5.64| RP:SCP:REP 188->294|1tg7A1|3e-10|12.4|97/97|b.149.1.1| HM:SCP:REP 6->115|1b9mA1|4e-24|35.2|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->293|1uthA_|1.2e-42|27.8|209/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 8121 OP:NHOMOORG 635 OP:PATTERN -----------------------1-------------1---------------1-------------- 323-31--2231--11-----1---6------11113367-114-1-1----221--1--21--1193631-------1-13411-1111-1---------5---3-1-2---------------1---1----1-344-1---21933444422221111111539534111111111111112------31766666676366556543879A669-2382322443338J---------------31112-211121-2-122----1-1--12-1---------------------------------------------2136222223222214331111511--22512563312-141-----12311J44911111L4UTT547DJ6E9BBB9A8C9ACQ-AHPB9WDOMn71*bbMbhb*xqcgSO6879GQC7ADAOR88888888FJJ7B58D-----------------------------127J96HpbOo******YSUWS****abccKh*z*kx*m-2ZWXC8OGIwFbHtABVB664BW833333333436JD622-2131128223-2--51411145366F131-------------------1-11-88NIMB7Ac8EE8FKKKICKMJFGCMFMPEXP1--33381-----JEHJ6NHFFGDFDABDD-GEEDGABDGCGCGDDEED7dmcIH6E8GAFCGEGFGFFCFCCEtA87AAA84-E77898767999---3-2--2243435XMb755B4D133425332NNOPQAC687b5qtlri*ysVhkjoFaXb555-355356GLMZKJKKJOUNNLabGKMLI66751111-2-11--------------------------------------------------251 --------------------------------------------------------------------------------------------------------------------------------------------------------------3----3------G--5-1--------11--5-----8---- --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 305 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHHHTTccccHHHHHHHTTccHHHHHHHHHHHHHTTcEEEcTTccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHTTTccHHHHHHHHHHcccccccTTccEEccccHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTTHHHHHTTccTTcEEEEcccccEEEETTEEEEEEEGGGcTTccTTcEEEEEEcGGGcEEEcHHTccEEEEEGGGccHTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHHccEEEEEEE DISOP:02AL 1-3,85-94,295-306| PSIPRED cccccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccEEEEEcccccccEEEEEEEcccEEEEccHHHHHHccccccHHHHHcccEEEEcccHHHHHHHHHcccccccccccEEEccHHHHHHHHHccccEEEEcHHHHHHHHHccccEEEccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccHHHHHHcccc //