[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : gcvR
DDBJ      :gcvR         glycine cleavage system transcriptional repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  152/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->178 1u8sB PDBj 2e-34 44.7 %
:RPS:PDB   10->165 3dc2A PDBj 7e-08 10.6 %
:RPS:SCOP  10->55 1zpvA1  d.58.18.7 * 1e-13 32.6 %
:RPS:SCOP  91->178 1u8sA2  d.58.18.5 * 9e-09 34.1 %
:HMM:SCOP  4->89 1u8sA1 d.58.18.5 * 2.3e-19 24.4 %
:HMM:SCOP  90->180 1u8sA2 d.58.18.5 * 8.1e-19 22.0 %
:HMM:PFM   10->49 PF01842 * ACT 4.6e-07 25.0 40/66  
:HMM:PFM   97->166 PF01842 * ACT 1e-06 18.8 64/66  
:BLT:SWISS 1->190 GCVR_SHIFL 5e-90 85.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68645.1 GT:GENE gcvR GT:PRODUCT glycine cleavage system transcriptional repressor GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2661590..2662162 GB:FROM 2661590 GB:TO 2662162 GB:DIRECTION + GB:GENE gcvR GB:PRODUCT glycine cleavage system transcriptional repressor GB:NOTE identified by match to protein family HMM PF01842 GB:PROTEIN_ID ACF68645.1 GB:DB_XREF GI:194408426 GB:GENE:GENE gcvR LENGTH 190 SQ:AASEQ MTPSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGDEFTFIMLLSGTWNAITLIESTLPLKGAELDLLIVMKRTSDRPRPAMPATVWVQVEVADSPHLIERFTALFNSHEMNIAELVSRTQPAEGDKAAQLFIQITAHSPASQNSANIEQAFKALCTELNAQGSINVVNYSQHDEQDGVK GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 1->190|GCVR_SHIFL|5e-90|85.8|190/190| BL:PDB:NREP 1 BL:PDB:REP 4->178|1u8sB|2e-34|44.7|170/172| RP:PDB:NREP 1 RP:PDB:REP 10->165|3dc2A|7e-08|10.6|142/526| HM:PFM:NREP 2 HM:PFM:REP 10->49|PF01842|4.6e-07|25.0|40/66|ACT| HM:PFM:REP 97->166|PF01842|1e-06|18.8|64/66|ACT| RP:SCP:NREP 2 RP:SCP:REP 10->55|1zpvA1|1e-13|32.6|46/83|d.58.18.7| RP:SCP:REP 91->178|1u8sA2|9e-09|34.1|82/85|d.58.18.5| HM:SCP:REP 4->89|1u8sA1|2.3e-19|24.4|86/86|d.58.18.5|1/2|ACT-like| HM:SCP:REP 90->180|1u8sA2|8.1e-19|22.0|91/93|d.58.18.5|2/2|ACT-like| OP:NHOMO 154 OP:NHOMOORG 154 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-1--------1-----------------------------11-1--1-11-1111111111111111111---1111------11111111111111111-111111111111111111111111111111111111111111111111-111-11-111111111-------------111---------------------------------1---11111--------------1111111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 92.1 SQ:SECSTR ###cccEEEHTGGGcccccccccHHHHHHHHccEEEEEEEcccccccEEEEEEEEcTTccEEEEEEEEETTTTEEEEEEETTEEcccEEEEEcccEEEEEEEcccTTHHHHHHHHHHHTTccEEEEEEEcccccccEcEEEEEEEEEEEcTTccccccHHHHHHHHHHTTcEEEEEEE############ DISOP:02AL 1-4,133-134,183-191| PSIPRED cccccccEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEEEcccccHHHEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEcccccccccccc //