[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : glnH
DDBJ      :glnH         glutamine ABC transporter, glutamine-binding periplasmic protein
Swiss-Prot:GLNH_ECOLI   RecName: Full=Glutamine-binding periplasmic protein;         Short=GlnBP;Flags: Precursor;

Homologs  Archaea  30/68 : Bacteria  707/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:248 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->248 1wdnA PDBj e-125 96.4 %
:RPS:PDB   25->246 3delB PDBj 2e-44 22.2 %
:RPS:SCOP  27->246 1gggA  c.94.1.1 * 6e-54 96.4 %
:HMM:SCOP  1->248 2a5sA1 c.94.1.1 * 2.2e-73 42.5 %
:RPS:PFM   35->243 PF00497 * SBP_bac_3 7e-37 39.7 %
:HMM:PFM   27->244 PF00497 * SBP_bac_3 2.5e-73 41.3 218/225  
:BLT:SWISS 1->248 GLNH_ECOLI e-138 96.8 %
:PROS 48->61|PS01039|SBP_BACTERIAL_3

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69016.1 GT:GENE glnH GT:PRODUCT glutamine ABC transporter, glutamine-binding periplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(945699..946445) GB:FROM 945699 GB:TO 946445 GB:DIRECTION - GB:GENE glnH GB:PRODUCT glutamine ABC transporter, glutamine-binding periplasmic protein GB:NOTE identified by match to protein family HMM PF00497; match to protein family HMM TIGR01096 GB:PROTEIN_ID ACF69016.1 GB:DB_XREF GI:194408797 GB:GENE:GENE glnH LENGTH 248 SQ:AASEQ MKSLLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWDAIAKELKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDIKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGESLEAQQYGVAFPKGSDELREKVNGALKTLRENGTYNEIYKKWFGTEPK GT:EXON 1|1-248:0| SW:ID GLNH_ECOLI SW:DE RecName: Full=Glutamine-binding periplasmic protein; Short=GlnBP;Flags: Precursor; SW:GN Name=glnH; OrderedLocusNames=b0811, JW0796; SW:KW 3D-structure; Amino-acid transport; Complete proteome;Direct protein sequencing; Periplasm; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->248|GLNH_ECOLI|e-138|96.8|248/248| GO:SWS:NREP 3 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 48->61|PS01039|SBP_BACTERIAL_3|PDOC00798| BL:PDB:NREP 1 BL:PDB:REP 26->248|1wdnA|e-125|96.4|223/223| RP:PDB:NREP 1 RP:PDB:REP 25->246|3delB|2e-44|22.2|221/232| RP:PFM:NREP 1 RP:PFM:REP 35->243|PF00497|7e-37|39.7|209/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 27->244|PF00497|2.5e-73|41.3|218/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 27->246|1gggA|6e-54|96.4|220/220|c.94.1.1| HM:SCP:REP 1->248|2a5sA1|2.2e-73|42.5|247/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3405 OP:NHOMOORG 742 OP:PATTERN 11---1----------1-2222112--11-1111----7689311113----1----1------1--- ----332122212132211-18112B1111116777369B15223131222-545123--111-7548381644476621311--------------------------121111111111111-1-1-11-5-1-111221112--2241121111-------111336-------------2441111--2634444475445544533325644532254444444439422222222222222222222564688775556666773646843337676555498777978876785554455655555488B99888824758453555523245332333232213113177-5121-211112128---11111311322855112111125653526656J---6--4-859-1MDDCFDCIFICFA4---13842341341111111132211212----------111111111111111--1-2-----49778KKKMLL77887FFEK888868KEM5A85--AB933A5485D8DF123-1--753322222---12-1591676B34977746166-51-132-31--4-6437344443222222222-22----676-2-1---4-1111--21111212-1112-4-1--------88GE5B87776775777-7787777677777677669DGBDC442C8798A9999A99998B766767731967787776888--3-111116666--26733353522222222144444-43551-98898GFH67978398B----------44484444465533----1-----------17----11--------2-33-2----------------------231-114111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1--1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 100.0 SQ:SECSTR TTTcEcEEEEEcccTTTcEEEEcccEEEEEEccccTTTcEEcTTcEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHcTTccHEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGcc DISOP:02AL 247-249| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEcccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccEEEEEccccccHHHHHHHcccccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEEEcHHHHHHHHHHcccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccc //