[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : glnP
DDBJ      :glnP         glutamine ABC transporter, permease protein
Swiss-Prot:GLNP_SHIFL   RecName: Full=Glutamine transport system permease protein glnP;

Homologs  Archaea  30/68 : Bacteria  689/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:219 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   59->139 3dhwA PDBj 4e-04 28.2 %
:RPS:PDB   114->139 3dhwA PDBj 2e-06 34.6 %
:RPS:SCOP  3->216 2r6gG1  f.58.1.1 * 5e-22 13.1 %
:HMM:PFM   33->217 PF00528 * BPD_transp_1 3.4e-27 20.7 179/185  
:BLT:SWISS 1->219 GLNP_SHIFL 5e-99 95.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67361.1 GT:GENE glnP GT:PRODUCT glutamine ABC transporter, permease protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(944896..945555) GB:FROM 944896 GB:TO 945555 GB:DIRECTION - GB:GENE glnP GB:PRODUCT glutamine ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF67361.1 GB:DB_XREF GI:194407142 GB:GENE:GENE glnP LENGTH 219 SQ:AASEQ MQFDWSAIWPAIPLLLEGAKMTLWISVLGLAGGLVIGLAAGFARTFGGWFANHIALVFIEIIRGTPIVVQVMFIYFALPMAFNDLRIDPFSAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRRETIRHVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL GT:EXON 1|1-219:0| SW:ID GLNP_SHIFL SW:DE RecName: Full=Glutamine transport system permease protein glnP; SW:GN Name=glnP; OrderedLocusNames=SF0761, S0803; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|GLNP_SHIFL|5e-99|95.4|219/219| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 21->43| TM:REGION 56->78| TM:REGION 88->110| TM:REGION 188->209| SEG 28->43|lglagglviglaagfa| SEG 140->151|lplalrrmlppl| BL:PDB:NREP 1 BL:PDB:REP 59->139|3dhwA|4e-04|28.2|78/203| RP:PDB:NREP 1 RP:PDB:REP 114->139|3dhwA|2e-06|34.6|26/203| HM:PFM:NREP 1 HM:PFM:REP 33->217|PF00528|3.4e-27|20.7|179/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 3->216|2r6gG1|5e-22|13.1|214/284|f.58.1.1| OP:NHOMO 4107 OP:NHOMOORG 723 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2212--1-1----2------2--- ----42133332213------5---B------555513B812124163222-747124--212-5667373644465531431---------------------------11111111111111-----1--4----22341111-12221123311-11----1--3321-1211--1111-1341111--26455555875566556623397556333754255555396222222222222222222246657AA885676666A93757D533388875665AA77766677676666656666666675798877781355656454552322433233321221423319A-4132-1111111171--11112412411K67122312222365347556N-22E22C27CH-3iQQNPSUTTeIKK9---14H32352351111111133511-26----------111111111111111--1-3--11-2DB8FMKKJMJB8BBBEEHTCBCC9CGGW5794-287C7575488FDKP244----944422222---25--1J-797C56CAAA42-23-3-------1--5-3341555553333333333-13----79B-3-----A-1111--11111111-11-2---1--------99LK7AA8888886887-88A8888888888788779FJDMK7769796A99999999979E88788883-CCCCCCBBCCCC--5-222221111--69B44452522212333244444-54451-GEEGGNIO9DFBC5HGI----------5558888889887711---------------2----------------3627----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------6-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 35.6 SQ:SECSTR ##########################################################HHHHHHccHHHHHHHHHHHHHTTcccccHH###HHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTT################################################################################ PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //