[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : glnQ
DDBJ      :glnQ         glutamine ABC transporter, ATP-binding protein
Swiss-Prot:GLNQ_ECOLI   RecName: Full=Glutamine transport ATP-binding protein glnQ;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:240 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->239 2oukB PDBj 2e-65 50.6 %
:RPS:PDB   2->229 3b5jA PDBj 4e-52 30.5 %
:RPS:SCOP  1->239 1b0uA  c.37.1.12 * 9e-57 50.2 %
:HMM:SCOP  4->218 1ii8.1 c.37.1.12 * 4.2e-77 41.8 %
:RPS:PFM   41->165 PF00005 * ABC_tran 4e-20 47.5 %
:HMM:PFM   41->165 PF00005 * ABC_tran 1.2e-28 40.5 116/118  
:HMM:PFM   15->53 PF03193 * DUF258 1.3e-06 23.7 38/161  
:BLT:SWISS 1->240 GLNQ_ECOLI e-122 97.1 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68041.1 GT:GENE glnQ GT:PRODUCT glutamine ABC transporter, ATP-binding protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(944177..944899) GB:FROM 944177 GB:TO 944899 GB:DIRECTION - GB:GENE glnQ GB:PRODUCT glutamine ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF68041.1 GB:DB_XREF GI:194407822 GB:GENE:GENE glnQ LENGTH 240 SQ:AASEQ MIEFKNVSKHFGPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGVKKEEAEKQAKALLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQALIENPPSPRLQEFLQHVS GT:EXON 1|1-240:0| SW:ID GLNQ_ECOLI SW:DE RecName: Full=Glutamine transport ATP-binding protein glnQ; SW:GN Name=glnQ; OrderedLocusNames=b0809, JW0794; SW:KW Amino-acid transport; ATP-binding; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->240|GLNQ_ECOLI|e-122|97.1|240/240| GO:SWS:NREP 7 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 109->123|kkeeaekqakallak| BL:PDB:NREP 1 BL:PDB:REP 1->239|2oukB|2e-65|50.6|239/241| RP:PDB:NREP 1 RP:PDB:REP 2->229|3b5jA|4e-52|30.5|226/243| RP:PFM:NREP 1 RP:PFM:REP 41->165|PF00005|4e-20|47.5|120/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->165|PF00005|1.2e-28|40.5|116/118|ABC_tran| HM:PFM:REP 15->53|PF03193|1.3e-06|23.7|38/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->239|1b0uA|9e-57|50.2|239/258|c.37.1.12| HM:SCP:REP 4->218|1ii8.1|4.2e-77|41.8|213/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 51266 OP:NHOMOORG 1172 OP:PATTERN XXNCQOJJWWWTWSZOnKTTPRPa*PSmqblZIBDDECHGGFDWcRYoNS**kAVgRTYOUKLHb1AA WbvR*fagonrXaTXUVQQ-Qk99X*QQQQQNxstu****Z*e*z**iynhV***SUeEE***k*t****gbdcc*hgdQ*hpBCDACRROK5JDGJ--FGULKKZOXQPAAAAAAADDDCCCCIUQMUaPMXWbUq****MLL*dvnpzghmcjYZQKMIOIegdn***eHQFKJKJRGLGHldfUS*qBYev************************fou**jqyvwsvw**Xmnnnnkilmmmmllahcbd*daZ**XOZYgrqNO**cWQajhggisruxvqywxwvytwurvzswufffedgihhihef*ssjhhtsuon***********h*lx***Ynnj*olyv*dmUN**xjbfjmUblbolPebbOeYWWMKOJKOfa***cVr****************-x**rq*v***TB**************IMO**********POPPPPPP*fiKUkc*66555555655665AB6888676687495KEGIFF************************s********DO**z*v*r*******gsqPWKQpcIIHHHHHTSNgwnd**UhYwtZuwhftLfcaVWbkYbhgdiz*a*LJKQGKKKMJGCBCCCCCCCKUGGJSRytyQzTfKUM*SYbcaOXdVUUXWXaXZdc5-CMYTN2-1222*z**a*z**********-*************yy*zxy*****ghkrqopqssssspqsqpq*vquxxv*X4************43KHEHEEFOOQNSL*t*bbaaZZLQUQOVNTdMOQNOFTJQUxe**x*****y****p***EEDBCEDCEJgrq*stttt*****VUWSTSSQSRGGFG86OVUUMMON9A889989*BXFDDEB-GCFEJGEOONBIOGKIAABanvXTs*twqEjN 1221aWH-dJ6CMWMFDFCCEGDR8PJCC8CBCKKHCGFEDFECDCJIIOJJUMKIKFDDDE9683571964967591676A99BF24-GNAD8ADA99B85BHGD5KgflPcXmZnKHHEKUNqnDuG**j3mQjLHL9eCJZPDNJGFYED*HXTPvJd*KpHgE*WY*SZZHEJGB*9ADDGjUc*9psCFrZdgO ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 240-241| PSIPRED cEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHcc //