[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : gloA
DDBJ      :gloA         lactoylglutathione lyase
Swiss-Prot:LGUL_SALTY   RecName: Full=Lactoylglutathione lyase;         EC=4.4.1.5;AltName: Full=Methylglyoxalase;AltName: Full=Aldoketomutase;AltName: Full=Glyoxalase I;         Short=Glx I;AltName: Full=Ketone-aldehyde mutase;AltName: Full=S-D-lactoylglutathione methylglyoxal lyase;

Homologs  Archaea  8/68 : Bacteria  485/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->125 1f9zA PDBj 3e-66 92.0 %
:RPS:PDB   1->131 3e0rA PDBj 8e-29 19.5 %
:RPS:SCOP  1->128 1f9zA  d.32.1.1 * 5e-30 89.8 %
:HMM:SCOP  1->135 1f9zA_ d.32.1.1 * 3.5e-35 36.3 %
:RPS:PFM   2->122 PF00903 * Glyoxalase 3e-13 42.2 %
:HMM:PFM   3->123 PF00903 * Glyoxalase 2.4e-27 30.5 118/128  
:BLT:SWISS 1->135 LGUL_SALTY 3e-76 100.0 %
:PROS 5->26|PS00934|GLYOXALASE_I_1
:PROS 69->81|PS00935|GLYOXALASE_I_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67339.1 GT:GENE gloA GT:PRODUCT lactoylglutathione lyase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1559570..1559977) GB:FROM 1559570 GB:TO 1559977 GB:DIRECTION - GB:GENE gloA GB:PRODUCT lactoylglutathione lyase GB:NOTE identified by match to protein family HMM PF00903; match to protein family HMM TIGR00068 GB:PROTEIN_ID ACF67339.1 GB:DB_XREF GI:194407120 GB:GENE:GENE gloA LENGTH 135 SQ:AASEQ MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN GT:EXON 1|1-135:0| SW:ID LGUL_SALTY SW:DE RecName: Full=Lactoylglutathione lyase; EC=4.4.1.5;AltName: Full=Methylglyoxalase;AltName: Full=Aldoketomutase;AltName: Full=Glyoxalase I; Short=Glx I;AltName: Full=Ketone-aldehyde mutase;AltName: Full=S-D-lactoylglutathione methylglyoxal lyase; SW:GN Name=gloA; OrderedLocusNames=STM1435; SW:KW Complete proteome; Lyase; Metal-binding; Nickel. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->135|LGUL_SALTY|3e-76|100.0|135/135| GO:SWS:NREP 2 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 5->26|PS00934|GLYOXALASE_I_1|PDOC00720| PROS 69->81|PS00935|GLYOXALASE_I_2|PDOC00720| BL:PDB:NREP 1 BL:PDB:REP 1->125|1f9zA|3e-66|92.0|125/128| RP:PDB:NREP 1 RP:PDB:REP 1->131|3e0rA|8e-29|19.5|118/235| RP:PFM:NREP 1 RP:PFM:REP 2->122|PF00903|3e-13|42.2|116/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 3->123|PF00903|2.4e-27|30.5|118/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->128|1f9zA|5e-30|89.8|128/128|d.32.1.1| HM:SCP:REP 1->135|1f9zA_|3.5e-35|36.3|135/0|d.32.1.1|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 872 OP:NHOMOORG 662 OP:PATTERN ------------------------21111111------------------------------------ ----------------------------------------------------------------------------------2---------------------------------------------------------------11111111-1111111111-11111111-1111--11--------1-111111-11-11---1-----11---------1111111---------------------1-------------------------1111---1111111111111111111111111111111111111-11-1---------------111---11--------------------11---1112-----231211112111122222122221-22122122111-2111221112111111121212222212222222223212111-----------------------------111211111111111111111111221111111121111-122113211111111111111111-1111111111211---------------------2-111111---------------------------11211221122211211112111111112122--11121------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----11111212111111111111111111111111111133231111211111111111-11111113321111133223111111111111111-1-11--------------------------------------------------21- ----112-21----1111111211111111111111121111111111131312212111111111111-111111111111111111-12111111111-11211--312333321-2--11221-213D2-22321--2-242221-12122-2122331-22222333113122216-1132546616211----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 97.0 SQ:SECSTR EEEEEEEEEEccHHHHHHHHTTTTcEEEEEccEEGGGTEEEcEEEEEcTTccEEEEEEEccTcccccccccEEEEEEEEccHHHHHHHHHTTcccccEEccEEEccccEEEEEEcTTccEEEEEccccGGG#### DISOP:02AL 129-136| PSIPRED ccEEEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEccccccEEEEEcccccccccccccccccEEEEEEccHHHHHHHHHHccccEEEEcccccccEEEEEEEEcccccEEEEEEcccccccccc //