[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : gloB
DDBJ      :gloB         hydroxyacylglutathione hydrolase
Swiss-Prot:GLO2_SALSV   RecName: Full=Hydroxyacylglutathione hydrolase;         EC=3.1.2.6;AltName: Full=Glyoxalase II;         Short=Glx II;

Homologs  Archaea  16/68 : Bacteria  594/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->251 2qedA PDBj e-151 99.6 %
:RPS:PDB   16->187 1dd6B PDBj 2e-24 16.9 %
:RPS:SCOP  1->251 1qh3A  d.157.1.2 * 3e-45 33.7 %
:HMM:SCOP  1->251 1qh5A_ d.157.1.2 * 1.6e-71 36.2 %
:RPS:PFM   22->135 PF00753 * Lactamase_B 9e-08 38.4 %
:HMM:PFM   10->165 PF00753 * Lactamase_B 1e-33 30.5 154/194  
:BLT:SWISS 1->251 GLO2_SALSV e-151 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66976.1 GT:GENE gloB GT:PRODUCT hydroxyacylglutathione hydrolase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(309129..309884) GB:FROM 309129 GB:TO 309884 GB:DIRECTION - GB:GENE gloB GB:PRODUCT hydroxyacylglutathione hydrolase GB:NOTE identified by match to protein family HMM PF00753; match to protein family HMM TIGR03413 GB:PROTEIN_ID ACF66976.1 GB:DB_XREF GI:194406757 GB:GENE:GENE gloB LENGTH 251 SQ:AASEQ MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF GT:EXON 1|1-251:0| SW:ID GLO2_SALSV SW:DE RecName: Full=Hydroxyacylglutathione hydrolase; EC=3.1.2.6;AltName: Full=Glyoxalase II; Short=Glx II; SW:GN Name=gloB; OrderedLocusNames=SeSA_A0291; SW:KW Complete proteome; Hydrolase; Metal-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->251|GLO2_SALSV|e-151|100.0|251/251| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| BL:PDB:NREP 1 BL:PDB:REP 1->251|2qedA|e-151|99.6|251/252| RP:PDB:NREP 1 RP:PDB:REP 16->187|1dd6B|2e-24|16.9|172/217| RP:PFM:NREP 1 RP:PFM:REP 22->135|PF00753|9e-08|38.4|112/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 10->165|PF00753|1e-33|30.5|154/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 1->251|1qh3A|3e-45|33.7|246/260|d.157.1.2| HM:SCP:REP 1->251|1qh5A_|1.6e-71|36.2|246/260|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 1362 OP:NHOMOORG 797 OP:PATTERN --------1111-1-1--------211-11-2--------------1-----------------1-11 -1--2--1-11-1112222-22222122222222222135-2211-11----11111-----1-123------------11311111-------1----1----1111-1--------------2-1------------1-1111-1311222222211111121111121111111111111-1--1--1111111111111111111111111111-111-1-1--1-11-1--1-1------------1-----------------------------------------------------------------------11-12-------1-121221111-11-1111111111--121-11-111-11-122112212122234312222211111111112-1111112122122221221322111132111111111111111111111112111-----------------------------211321111112222222222222222222222213323122322222221221122123222122222221111311422-----------------2----2-4122-------------------------111112321111121111112211121111112-1321211-11122122122222222222-222222222222222222222222221222222222222222222222222212222222222221111111111111211111112212221211122333331241111111111111111111122222222221222222221212322222222211111222122111-----------1-------------------------------------- 22--124-412--12111133223222113112312122222211111331-121211211111111111111112221211111111-12111111111111231126374232221-1-22365252AP6164A1322313411122-3-242212311-26211311232421112Q2231232342A22322222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR EEETTTEEEEEEEEEEEEEETTEEEEEcccHHHHHHHHHHTTTcEEEEEEcccccHHHHTTHHHHHHTTccEEEEHHHHTTcccccEEEcccEEEEETTTEEEEcccccccTTccEEETTTEEEEETTccTTcccccTTccTTTHHHHHHHHHHTTTccEEEEcccccccTHHHHHHHHHHHHHHHTcEEEEccTTcHHHHHHHHHHHHHTTcEEEEcEccccTTcEEEETETTTTTccccccccccTTTT DISOP:02AL 251-252| PSIPRED cEEEEEccccccEEEEEEEcccEEEEEccccHHHHHHHHHHccccEEEEEEEcccHHHccHHHHHHHHccccEEEcccccccccccEEcccccEEEEccEEEEEEEcccccccEEEEEEccEEEEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccc //