[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : glpB
DDBJ      :glpB         glycerol-3-phosphate dehydrogenase, anaerobic, B subunit
Swiss-Prot:GLPB_SALTY   RecName: Full=Anaerobic glycerol-3-phosphate dehydrogenase subunit B;         Short=Anaerobic G-3-P dehydrogenase subunit B;         Short=Anaerobic G3Pdhase B;         EC=1.1.5.3;

Homologs  Archaea  5/68 : Bacteria  117/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   331->415 1e39A PDBj 2e-06 11.8 %
:RPS:SCOP  359->414 1d7yA1  c.3.1.5 * 3e-04 19.6 %
:HMM:SCOP  1->416 2bs2A2 c.3.1.4 * 2.9e-17 22.8 %
:HMM:PFM   4->399 PF00890 * FAD_binding_2 6.1e-59 22.0 381/421  
:BLT:SWISS 1->419 GLPB_SALTY 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69590.1 GT:GENE glpB GT:PRODUCT glycerol-3-phosphate dehydrogenase, anaerobic, B subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2439416..2440675 GB:FROM 2439416 GB:TO 2440675 GB:DIRECTION + GB:GENE glpB GB:PRODUCT glycerol-3-phosphate dehydrogenase, anaerobic, B subunit GB:NOTE identified by match to protein family HMM PF00890; match to protein family HMM PF01266; match to protein family HMM TIGR03378 GB:PROTEIN_ID ACF69590.1 GB:DB_XREF GI:194409371 GB:GENE:GENE glpB LENGTH 419 SQ:AASEQ MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSPIATNCDMIIMPACFGLANDTLWRWLNERLPCALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFFDPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ GT:EXON 1|1-419:0| SW:ID GLPB_SALTY SW:DE RecName: Full=Anaerobic glycerol-3-phosphate dehydrogenase subunit B; Short=Anaerobic G-3-P dehydrogenase subunit B; Short=Anaerobic G3Pdhase B; EC=1.1.5.3; SW:GN Name=glpB; OrderedLocusNames=STM2285; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Flavoprotein;FMN; Membrane; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->419|GLPB_SALTY|0.0|100.0|419/419| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 9->26|ggglagllcglqlqqhgl| SEG 81->97|aqkvltlaqqaqtllna| SEG 239->251|lpcaltllptlpp| RP:PDB:NREP 1 RP:PDB:REP 331->415|1e39A|2e-06|11.8|85/568| HM:PFM:NREP 1 HM:PFM:REP 4->399|PF00890|6.1e-59|22.0|381/421|FAD_binding_2| RP:SCP:NREP 1 RP:SCP:REP 359->414|1d7yA1|3e-04|19.6|51/183|c.3.1.5| HM:SCP:REP 1->416|2bs2A2|2.9e-17|22.8|290/0|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 124 OP:NHOMOORG 122 OP:PATTERN ------------------------1--1111------------------------------------- ---------------------------------------------------------------1------------------------------------------------------------------------111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------31-11----11-1----------------1---------------------------11-----------------------------------------1-1111-1111111111-111111111111111111111111--1111111111111111111111111--111111111111------------------1111-1111111111---------------------------------------111111111---11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 20.8 SQ:SECSTR ##########################################################################################################################################################################################################################################################################################################################################ccTTTcccccccccccccEEEEEEEccEEEccTTcEEEcTTccEEEEEEEccTTEEcccTTcccTTHHHHHHHHHHHHHHHHHHcHc## DISOP:02AL 416-420| PSIPRED ccccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHHHHHcccEEccccccEEEEcccccccHHHcccccccccccccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEEEccEEEEEEEcccccEEEEccEEEEEEEEEEccccccccccEEccccccccccccccccccccccccccHHHHcccEEcHHHcccccccEEccEEEEccHHccccHHHHccccEEEHHHHHHHHHHHHHHHcccc //