[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : glpC
DDBJ      :glpC         glycerol-3-phosphate dehydrogenase, anaerobic, C subunit
Swiss-Prot:GLPC_ECOLI   RecName: Full=Anaerobic glycerol-3-phosphate dehydrogenase subunit C;         Short=G-3-P dehydrogenase;

Homologs  Archaea  42/68 : Bacteria  428/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.349.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->69 1k0tA PDBj 6e-07 40.7 %
:RPS:PDB   9->82 1d0cA PDBj 7e-10 13.9 %
:RPS:PDB   366->388 2cnjD PDBj 5e-04 26.1 %
:RPS:SCOP  6->82 1e7pB1  a.1.2.1 * 3e-13 19.5 %
:RPS:SCOP  300->367 2jovA1  d.349.1.1 * 3e-08 13.6 %
:HMM:SCOP  6->83 1nekB1 a.1.2.1 * 4.2e-16 26.9 %
:HMM:PFM   186->249 PF02754 * CCG 5.6e-11 27.9 61/64  
:HMM:PFM   316->377 PF02754 * CCG 3.1e-16 31.1 61/64  
:HMM:PFM   7->21 PF00037 * Fer4 3.1e-05 53.3 15/24  
:HMM:PFM   55->70 PF00037 * Fer4 5.4e-06 37.5 16/24  
:BLT:SWISS 1->395 GLPC_ECOLI 0.0 92.2 %
:PROS 9->20|PS00198|4FE4S_FER_1
:PROS 56->67|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70061.1 GT:GENE glpC GT:PRODUCT glycerol-3-phosphate dehydrogenase, anaerobic, C subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2440672..2441862 GB:FROM 2440672 GB:TO 2441862 GB:DIRECTION + GB:GENE glpC GB:PRODUCT glycerol-3-phosphate dehydrogenase, anaerobic, C subunit GB:NOTE identified by match to protein family HMM PF02754; match to protein family HMM TIGR03379 GB:PROTEIN_ID ACF70061.1 GB:DB_XREF GI:194409842 GB:GENE:GENE glpC LENGTH 396 SQ:AASEQ MSDTRFESCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCKRCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFILSHTDLMGSVSTPFAPVVNTATALKPVRQLLDYALKIDHRRTLPKYSFGTFRRWYRSVAAQQAKYKDQVAFFHGCFVNYNHPQLGKDLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAISNVESLREAIAVKGIPVIATSSTCTFALRDEYPEVLDVDNAGLREHIELATRWLWRKLDAGKTLPLNPLPLKVVYHTPCHMEKMGWTLYTLELLRQIPGLELTVLDSQCCGIAGTYGFKKENYPTSQSIGAPLFRQIEESGADIVVTDCETCKWQIEMSTSKRCEHPITLLAQALG GT:EXON 1|1-396:0| SW:ID GLPC_ECOLI SW:DE RecName: Full=Anaerobic glycerol-3-phosphate dehydrogenase subunit C; Short=G-3-P dehydrogenase; SW:GN Name=glpC; OrderedLocusNames=b2243, JW2237; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome;Direct protein sequencing; Electron transport; Iron; Iron-sulfur;Membrane; Metal-binding; Repeat; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->395|GLPC_ECOLI|0.0|92.2|395/396| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 9->20|PS00198|4FE4S_FER_1|PDOC00176| PROS 56->67|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 6->69|1k0tA|6e-07|40.7|54/80| RP:PDB:NREP 2 RP:PDB:REP 9->82|1d0cA|7e-10|13.9|72/416| RP:PDB:REP 366->388|2cnjD|5e-04|26.1|23/143| HM:PFM:NREP 4 HM:PFM:REP 186->249|PF02754|5.6e-11|27.9|61/64|CCG| HM:PFM:REP 316->377|PF02754|3.1e-16|31.1|61/64|CCG| HM:PFM:REP 7->21|PF00037|3.1e-05|53.3|15/24|Fer4| HM:PFM:REP 55->70|PF00037|5.4e-06|37.5|16/24|Fer4| RP:SCP:NREP 2 RP:SCP:REP 6->82|1e7pB1|3e-13|19.5|77/133|a.1.2.1| RP:SCP:REP 300->367|2jovA1|3e-08|13.6|66/77|d.349.1.1| HM:SCP:REP 6->83|1nekB1|4.2e-16|26.9|78/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 820 OP:NHOMOORG 473 OP:PATTERN ------1111111112-------1533223421111111111112111134431---1---------- 22311-11111-1--------1---2------1-----43--1-1--21----211----1122-24-2------------131211122---2-------2-1122211--------------------------23366---331111-1--111111111--1111-1------------21211---2-122222112-2121-232221-112232-2-1------11--------------------1---11---------11-1----111------------------------------------------------------------------------2--3-451531--53-----1--31---1-----11111--2---------------1-12122115111-111--22--111-2---111----1-111111111-------1-----------------------------2-----111123335331222233442222124424332-2--11211111331-22-1-1--1-------111-22-17232333224431746123533222212452--2111111111111111-1111111211-111-111--------111--1--------3--2------2-2121-3222323233-233333233323333233111121--3111111111111111111212222--111111111111-------------2-1-12222121111-2222----------31----1331-122321111111111111111311111---22-----------------------------------------------------------------------1- -------------1-----------------------------------------------------------------------------------------------1---------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 27.8 SQ:SECSTR ###HccccccHHHHHHHHHHHHHTcTTcTTGGGTTccEEEEcTTcccHHHHHHHHHHHHHHHHHHGGGccccEEEEcccccTHHHHHHHH###################################################################################################################################################################################################################################################################################EEETTTTEEEEEEEEGGGcccTT######## DISOP:02AL 1-1| PSIPRED ccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccHHHHHHHHccccccccccEEEEccccHHHccHHHHHHHHHHHHHcccEEEEccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHccccHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccccccHHHHHHHHcc //