[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : gpmA
DDBJ      :gpmA         2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Swiss-Prot:GPMA_SALTY   RecName: Full=2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;         Short=Phosphoglyceromutase;         Short=PGAM;         Short=BPG-dependent PGAM;         Short=dPGM;         EC=5.4.2.1;

Homologs  Archaea  11/68 : Bacteria  604/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->232 1e59A PDBj e-135 98.3 %
:RPS:PDB   2->232 1e58A PDBj 5e-72 97.4 %
:RPS:SCOP  5->231 1bq3A  c.60.1.1 * 7e-83 55.1 %
:HMM:SCOP  2->248 1e58A_ c.60.1.1 * 1.3e-77 43.7 %
:RPS:PFM   6->191 PF00300 * PGAM 9e-26 47.1 %
:HMM:PFM   5->191 PF00300 * PGAM 2e-45 46.2 158/158  
:BLT:SWISS 1->232 GPMA_SALTY e-137 100.0 %
:PROS 8->17|PS00175|PG_MUTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67350.1 GT:GENE gpmA GT:PRODUCT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(884631..885383) GB:FROM 884631 GB:TO 885383 GB:DIRECTION - GB:GENE gpmA GB:PRODUCT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GB:NOTE identified by match to protein family HMM PF00300; match to protein family HMM TIGR01258 GB:PROTEIN_ID ACF67350.1 GB:DB_XREF GI:194407131 GB:GENE:GENE gpmA LENGTH 250 SQ:AASEQ MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVIIAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKAAAVANQGKAK GT:EXON 1|1-250:0| SW:ID GPMA_SALTY SW:DE RecName: Full=2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; Short=Phosphoglyceromutase; Short=PGAM; Short=BPG-dependent PGAM; Short=dPGM; EC=5.4.2.1; SW:GN Name=gpmA; OrderedLocusNames=STM0772; SW:KW Complete proteome; Glycolysis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->232|GPMA_SALTY|e-137|100.0|232/250| GO:SWS:NREP 2 GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| PROS 8->17|PS00175|PG_MUTASE|PDOC00158| SEG 233->249|adeiaakaaavanqgka| BL:PDB:NREP 1 BL:PDB:REP 3->232|1e59A|e-135|98.3|230/239| RP:PDB:NREP 1 RP:PDB:REP 2->232|1e58A|5e-72|97.4|230/246| RP:PFM:NREP 1 RP:PFM:REP 6->191|PF00300|9e-26|47.1|157/158|PGAM| HM:PFM:NREP 1 HM:PFM:REP 5->191|PF00300|2e-45|46.2|158/158|PGAM| RP:SCP:NREP 1 RP:SCP:REP 5->231|1bq3A|7e-83|55.1|227/234|c.60.1.1| HM:SCP:REP 2->248|1e58A_|1.3e-77|43.7|247/247|c.60.1.1|1/1|Phosphoglycerate mutase-like| OP:NHOMO 1199 OP:NHOMOORG 749 OP:PATTERN ------------------------1------1----------111-111-111--------------- --11221111111111111-11111111111111112311112311111111111211111111121111112221221--1--12221122-111----1-----1---1111111111111111111111111122221---1-132111111111-1111--1211111-11111--11-1-111111--11111112111111111-11-1111111----334353-2-111111111111111221114524423444443344243344111111111122211111111111111111111111121111111121-13311111-1-----11111-2111----11--111--1--222-111---11131111111111111-1--111111111111-2412421221111--12211111111111------------------------1------------------------------111111222211111112111111221111111132222122221112221112133-----1-11111112221211-1--1-1-1-111-1-1-11-------1--1----------------------111--1--1-1--1-------------------1-1-1111-11111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-----------1---222222111111211-----------------------------------------------------11111111111111---1------1111111111---------------------------21-------1-1 1-11111-1------11-------1-1111111----------111-----1-1--------12222313232224423432252212----1------1161-----E1-4564434262243352649U6-34D23433236323335342433233221131117241--11-11-7-1--14114-42772433H ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 92.8 SQ:SECSTR TccEEEEEEEEcccHHHHTTcccTTccccccHHHHHHHHHHHHHHHHTTccccEEEEcccHHHHHHHHHHHHHHTcTTccEEEcGGGcccccGGGTTccHHHHHHHHcHHHHHHHHHcTTcccccccTTcTTcGGGcGGGTTccTTTccccccHHHHHHHHHHHHHHTHHHHHHTTccEEEEEcHHHHHHHHHHHTTccHHHHHHccccTTccEEEEEcTTccEEEEEEccc################## DISOP:02AL 1-1,248-251| PSIPRED cccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHcccccccEEEcccHHHccccccccccHHHHHHHccHHHHHHHHccccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHcccHHHHHccccccccEEEEEEcccccEEEHHHcccHHHHHHHHHHHHcccccc //