[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : holA
DDBJ      :holA         DNA polymerase III, delta subunit
Swiss-Prot:HOLA_ECOLI   RecName: Full=DNA polymerase III subunit delta;         EC=2.7.7.7;

Homologs  Archaea  0/68 : Bacteria  286/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.80.1c.37.1
:343 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->338 1jr3D PDBj e-159 90.5 %
:RPS:SCOP  1->140 1jqlB  c.37.1.20 * 8e-39 77.1 %
:RPS:SCOP  212->333 1jqjC1  a.80.1.1 * 1e-16 73.5 %
:HMM:SCOP  1->211 1jr3D2 c.37.1.20 * 2.6e-56 36.0 %
:HMM:SCOP  212->338 1jr3D1 a.80.1.1 * 4.1e-35 44.1 %
:RPS:PFM   22->190 PF06144 * DNA_pol3_delta 3e-26 39.2 %
:HMM:PFM   21->190 PF06144 * DNA_pol3_delta 6.3e-48 32.3 167/172  
:HMM:PFM   216->308 PF12169 * DNA_pol3_gamma3 7.1e-05 27.6 87/143  
:BLT:SWISS 1->343 HOLA_ECOLI e-161 90.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69177.1 GT:GENE holA GT:PRODUCT DNA polymerase III, delta subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(755905..756936) GB:FROM 755905 GB:TO 756936 GB:DIRECTION - GB:GENE holA GB:PRODUCT DNA polymerase III, delta subunit GB:NOTE identified by match to protein family HMM PF06144; match to protein family HMM TIGR01128 GB:PROTEIN_ID ACF69177.1 GB:DB_XREF GI:194408958 GB:GENE:GENE holA LENGTH 343 SQ:AASEQ MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAIRLAAASQGFEEHHAFTLDPSTDWGSLFSLCQAMSLFASRQTLVLQLPENGPNAAMNEQLATLSELLHDDLLLIVRGNKLTKAQENAAWYTALADRSVQVSCQTPEQAQLPRWVAARAKAQNLQLDDAANQLLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRPMIGDALQRLHPAQLRQAVQLLTRTEITLKQDYGQSVWADLEGLSLLLCHKALADVFIDG GT:EXON 1|1-343:0| SW:ID HOLA_ECOLI SW:DE RecName: Full=DNA polymerase III subunit delta; EC=2.7.7.7; SW:GN Name=holA; OrderedLocusNames=b0640, JW0635; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;DNA replication; DNA-directed DNA polymerase; Nucleotidyltransferase;Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->343|HOLA_ECOLI|e-161|90.7|343/343| GO:SWS:NREP 4 GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003887|"GO:DNA-directed DNA polymerase activity"|DNA-directed DNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 97->110|latlsellhddlll| SEG 246->262|llrtlqrellllvnlkr| BL:PDB:NREP 1 BL:PDB:REP 1->338|1jr3D|e-159|90.5|338/338| RP:PFM:NREP 1 RP:PFM:REP 22->190|PF06144|3e-26|39.2|166/168|DNA_pol3_delta| HM:PFM:NREP 2 HM:PFM:REP 21->190|PF06144|6.3e-48|32.3|167/172|DNA_pol3_delta| HM:PFM:REP 216->308|PF12169|7.1e-05|27.6|87/143|DNA_pol3_gamma3| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF06144|IPR010372| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF06144|IPR010372| GO:PFM GO:0006260|"GO:DNA replication"|PF06144|IPR010372| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF06144|IPR010372| RP:SCP:NREP 2 RP:SCP:REP 1->140|1jqlB|8e-39|77.1|140/140|c.37.1.20| RP:SCP:REP 212->333|1jqjC1|1e-16|73.5|117/117|a.80.1.1| HM:SCP:REP 1->211|1jr3D2|2.6e-56|36.0|211/211|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 212->338|1jr3D1|4.1e-35|44.1|127/127|a.80.1.1|1/1|DNA polymerase III clamp loader subunits, C-terminal domain| OP:NHOMO 287 OP:NHOMOORG 286 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111---------------1-----------------------------------------111111111111111111111111111111111-1111111-11111111111111111111-1121111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111---1111111111111111111---------1111111111111111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 98.5 SQ:SECSTR cEEEcTTTHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHTccEEEEEEccTTccHHHHHHHHHHHHHccccEEEEEEcccccccTTHHHHHHHHHTTccTTEEEEEEEccccTTTTTcHHHHHHTTTcEEEEEccccTTHHHHHHHHHHHHTTcEEcHHHHHHHHHccTTcHHHHHHHHHHHHHHcTTcEEcHHHHHHHHHHHccccHHHHHHHHTTccHHHHHHHHTccTTTTccHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHTccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHTTcccccc##### DISOP:02AL 1-1,267-267,269-269,343-344| PSIPRED cccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccc //