[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : hybD.1
DDBJ      :hybD         hydrogenase expression/formation protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  184/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->158 1cfzA PDBj 3e-25 39.9 %
:RPS:PDB   4->158 1cfzA PDBj 2e-38 39.9 %
:RPS:SCOP  4->158 1cfzA  c.56.1.1 * 3e-47 39.2 %
:HMM:SCOP  2->164 1cfzA_ c.56.1.1 * 5.9e-40 39.1 %
:RPS:PFM   25->146 PF01750 * HycI 8e-25 47.5 %
:RPS:PFM   129->163 PF10441 * Urb2 8e-04 40.0 %
:HMM:PFM   21->147 PF01750 * HycI 2.3e-38 45.7 127/130  
:HMM:PFM   121->177 PF12486 * DUF3702 0.0005 28.6 56/148  
:BLT:SWISS 3->197 HUPD_THIRO 5e-51 48.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67258.1 GT:GENE hybD.1 GT:PRODUCT hydrogenase expression/formation protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1657815..1658423) GB:FROM 1657815 GB:TO 1658423 GB:DIRECTION - GB:GENE hybD GB:PRODUCT hydrogenase expression/formation protein GB:NOTE identified by match to protein family HMM PF01750; match to protein family HMM TIGR00072; match to protein family HMM TIGR00140 GB:PROTEIN_ID ACF67258.1 GB:DB_XREF GI:194407039 GB:GENE:GENE hybD LENGTH 202 SQ:AASEQ MAEVTILGLGNLLWADEGFGVRAAEKLFEQYADNEKVDVVDGGTQGLALLPWLQQTEKLLIMDAIDFGMAPGSLAMFRDEQVPAYLTAKKLSLHQTSFSEVLALLQLTGGQLSEIVLIGVQPKCLDDYGGSLTPQVKAQLMPAVYLAQEVLAQWGITASSAALPTERLNHYSLCMERYEDERPDAQSACRVGDIRVLQREKS GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 3->197|HUPD_THIRO|5e-51|48.2|195/221| BL:PDB:NREP 1 BL:PDB:REP 4->158|1cfzA|3e-25|39.9|153/162| RP:PDB:NREP 1 RP:PDB:REP 4->158|1cfzA|2e-38|39.9|153/162| RP:PFM:NREP 2 RP:PFM:REP 25->146|PF01750|8e-25|47.5|120/128|HycI| RP:PFM:REP 129->163|PF10441|8e-04|40.0|35/221|Urb2| HM:PFM:NREP 2 HM:PFM:REP 21->147|PF01750|2.3e-38|45.7|127/130|HycI| HM:PFM:REP 121->177|PF12486|0.0005|28.6|56/148|DUF3702| GO:PFM:NREP 2 GO:PFM GO:0008047|"GO:enzyme activator activity"|PF01750|IPR000671| GO:PFM GO:0008233|"GO:peptidase activity"|PF01750|IPR000671| RP:SCP:NREP 1 RP:SCP:REP 4->158|1cfzA|3e-47|39.2|153/162|c.56.1.1| HM:SCP:REP 2->164|1cfzA_|5.9e-40|39.1|161/0|c.56.1.1|1/1|HybD-like| OP:NHOMO 283 OP:NHOMOORG 194 OP:PATTERN --------1-------------------------11-2211-1-1-1--------------------- 1-1---1----------------------------------------------------------------------------1111------1-------1-----------------------11-111-1111---32111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--1---1---------1----------1-212---111-1------------------------------------11-----11111-----------1----1-1------------------------------------------------------1-------1---11------1----1-1----11----------------12-11-111221122112122122-1-------111111------11--------11121111-1--------1111-111111111111-----1-1------1-112--2222222222-2222222222222222222---1---13333333333333333-2222222--1------------------------1----111111-------------------1---------------------------1------------------------------1-------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 81.2 SQ:SECSTR ##cEEEEEEccTTcGGGGHHHHHHHHHHHHEEccTTEEEEEEETccGGGHHHHccccEEEEEEEccccccTTcEEEEETTHHHHHHccTcccHHHHHHHHHHHHHHHTTccccEEEEEEEcccccccccccccHHHHTTHHHHHHHHHHHHHTTTcccTccccccc#################################### DISOP:02AL 1-1,179-180,200-203| PSIPRED cccEEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHcccEEEEEEcccccccccEEEEEcHHHHccccccccccHHHccHHHHHHHHHHccccccEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHccHHHcccccc //