[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : hycG
DDBJ      :hycG         formate hydrogenlyase, subunit G
Swiss-Prot:HYCG_ECOLI   RecName: Full=Formate hydrogenlyase subunit 7;         Short=FHL subunit 7;AltName: Full=Hydrogenase-3 component G;

Homologs  Archaea  66/68 : Bacteria  604/915 : Eukaryota  138/199 : Viruses  0/175   --->[See Alignment]
e.19.1e.24.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->174 3i9v6 PDBj 4e-09 31.2 %
:RPS:PDB   40->160 1e3dA PDBj 8e-22 22.3 %
:RPS:SCOP  1->48 1ad2A  e.24.1.1 * 4e-04 29.5 %
:RPS:SCOP  54->178 2fug61  e.19.1.2 * 8e-30 34.2 %
:HMM:SCOP  36->180 2fug61 e.19.1.2 * 1.7e-46 45.1 %
:RPS:PFM   48->154 PF01058 * Oxidored_q6 2e-14 42.5 %
:HMM:PFM   48->157 PF01058 * Oxidored_q6 2.3e-26 34.5 110/131  
:BLT:SWISS 1->255 HYCG_ECOLI e-138 92.2 %
:PROS 131->147|PS01150|COMPLEX1_20K
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66987.1 GT:GENE hycG GT:PRODUCT formate hydrogenlyase, subunit G GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2967086..2967853) GB:FROM 2967086 GB:TO 2967853 GB:DIRECTION - GB:GENE hycG GB:PRODUCT formate hydrogenlyase, subunit G GB:NOTE identified by match to protein family HMM PF01058 GB:PROTEIN_ID ACF66987.1 GB:DB_XREF GI:194406768 GB:GENE:GENE hycG LENGTH 255 SQ:AASEQ MSNLLGPRDANGIPVPMTVDESIASMKASLLKNIKRSAYVYRVDCGGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLLEQKIHARAPGELDDQPAEILHPDMVQPLRVKVDRAARRLAGYRYGRQIADDYLTQLGQGEQQVARWLEAENDPRLTEIVTHLNHVVEEARIR GT:EXON 1|1-255:0| SW:ID HYCG_ECOLI SW:DE RecName: Full=Formate hydrogenlyase subunit 7; Short=FHL subunit 7;AltName: Full=Hydrogenase-3 component G; SW:GN Name=hycG; Synonyms=hevG; OrderedLocusNames=b2719, JW2689; SW:KW 4Fe-4S; Complete proteome; Iron; Iron-sulfur; Metal-binding;Oxidoreductase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->255|HYCG_ECOLI|e-138|92.2|255/255| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 131->147|PS01150|COMPLEX1_20K|PDOC00858| SEG 197->209|raarrlagyrygr| BL:PDB:NREP 1 BL:PDB:REP 77->174|3i9v6|4e-09|31.2|93/145| RP:PDB:NREP 1 RP:PDB:REP 40->160|1e3dA|8e-22|22.3|121/262| RP:PFM:NREP 1 RP:PFM:REP 48->154|PF01058|2e-14|42.5|106/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 48->157|PF01058|2.3e-26|34.5|110/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 2 RP:SCP:REP 1->48|1ad2A|4e-04|29.5|44/224|e.24.1.1| RP:SCP:REP 54->178|2fug61|8e-30|34.2|120/144|e.19.1.2| HM:SCP:REP 36->180|2fug61|1.7e-46|45.1|144/0|e.19.1.2|1/1|HydA/Nqo6-like| OP:NHOMO 1239 OP:NHOMOORG 808 OP:PATTERN 113-3121222222213112222121111211212223222222132411233132242532111-11 22212---------12122-21--21222222111-11112111-1--1-----------22212112221--------21111211211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--1--112221----22--211--23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533112231111111111111111111111111111111111-111111111111222211123233221131122111111111111231111111112111111-11122211-1-2-1-442223-433243418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111112-222222------------------------------------121111-11-251 ----111-211-11111211122223122121222-1222122111-1112132-1212111111----1--111------11111---12111111111111112-1-32211111-------22-1-3F1-321----3--2------1--1----111-1111232121121111-----1123-21131134231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 63.9 SQ:SECSTR ###########TccccccHHHHHHHHHHHHHHTTcccEEEEEEEcccccHHHHHHHTccTTcHHHHHHTTHHHHTcccccEEEEEccEEcTGEEHHHHHHHHGGGccEEEEEcHHHHHcGGGGcEEcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHHHHHcTTTcccccT################################################################################# DISOP:02AL 1-19,165-181,255-256| PSIPRED ccccccccccccccccccccccEEEEEHHHHHHHcccccEEEEEcccccHHHHHHHHHccccccHHHccEEEcccHHHccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccccccccccccHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHccc //