[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : hycI
DDBJ      :hycI         hydrogenase maturation peptidase HycI
Swiss-Prot:HYCI_ECOLI   RecName: Full=Hydrogenase 3 maturation protease;         EC=3.4.23.-;

Homologs  Archaea  20/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->155 2i8lA PDBj 8e-83 91.6 %
:RPS:PDB   3->151 2e85B PDBj 5e-28 93.3 %
:RPS:SCOP  1->142 1cfzA  c.56.1.1 * 5e-16 21.4 %
:HMM:SCOP  1->156 1cfzA_ c.56.1.1 * 6.6e-35 27.9 %
:RPS:PFM   30->135 PF01750 * HycI 1e-08 39.4 %
:HMM:PFM   25->138 PF01750 * HycI 8.5e-29 27.7 112/130  
:BLT:SWISS 1->155 HYCI_ECOLI 2e-82 91.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67322.1 GT:GENE hycI GT:PRODUCT hydrogenase maturation peptidase HycI GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2966216..2966686) GB:FROM 2966216 GB:TO 2966686 GB:DIRECTION - GB:GENE hycI GB:PRODUCT hydrogenase maturation peptidase HycI GB:NOTE identified by match to protein family HMM PF01750; match to protein family HMM TIGR00072; match to protein family HMM TIGR00142 GB:PROTEIN_ID ACF67322.1 GB:DB_XREF GI:194407103 GB:GENE:GENE hycI LENGTH 156 SQ:AASEQ MTDVLLCVGNSMMGDDGAGPLLAEMCAAQPKGNWVVIDGGSVPENDIVAIRELRPQRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDVGEVIFVGIQPDIVGFYYPMTQPIKDAVNIVYQRLEGWQGNGGFAALEAPEA GT:EXON 1|1-156:0| SW:ID HYCI_ECOLI SW:DE RecName: Full=Hydrogenase 3 maturation protease; EC=3.4.23.-; SW:GN Name=hycI; OrderedLocusNames=b2717, JW2687; SW:KW 3D-structure; Aspartyl protease; Complete proteome;Direct protein sequencing; Hydrolase; Metal-binding; Nickel; Protease. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|HYCI_ECOLI|2e-82|91.6|155/156| GO:SWS:NREP 4 GO:SWS GO:0004190|"GO:aspartic-type endopeptidase activity"|Aspartyl protease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| BL:PDB:NREP 1 BL:PDB:REP 1->155|2i8lA|8e-83|91.6|155/156| RP:PDB:NREP 1 RP:PDB:REP 3->151|2e85B|5e-28|93.3|149/157| RP:PFM:NREP 1 RP:PFM:REP 30->135|PF01750|1e-08|39.4|104/128|HycI| HM:PFM:NREP 1 HM:PFM:REP 25->138|PF01750|8.5e-29|27.7|112/130|HycI| GO:PFM:NREP 2 GO:PFM GO:0008047|"GO:enzyme activator activity"|PF01750|IPR000671| GO:PFM GO:0008233|"GO:peptidase activity"|PF01750|IPR000671| RP:SCP:NREP 1 RP:SCP:REP 1->142|1cfzA|5e-16|21.4|140/162|c.56.1.1| HM:SCP:REP 1->156|1cfzA_|6.6e-35|27.9|154/0|c.56.1.1|1/1|HybD-like| OP:NHOMO 101 OP:NHOMOORG 99 OP:PATTERN --------------------------------11111111111--111------1111-11------- -------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----1-------------------1---------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------2------1--111-----------------1-----11-----------------------------------------111111-1111111111-11111111111111111111111---111111111111111111111--11--1---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEccTTcGGGGHHHHHHHHHHHcccTTcEEEEEETccGGGHHHHHHHcccEEEEEEEccccccTTcEEEccHHHHHHTTcccTTcccHHHHHHHHHHHHccEEEEEEccccccTTccccHHHHHHHHHHHHHcTTccTTTTccccEGGGc DISOP:02AL 153-157| PSIPRED cEEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEEEcHHccccccEEEEEcHHHHHHHHccccccccHHHHHHHHHcccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccccccc //