[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : hyi
DDBJ      :hyi          hydroxypyruvate isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  272/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
c.1.15
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->258 1k77A PDBj 2e-53 39.9 %
:RPS:PDB   1->254 1dxiA PDBj 7e-39 15.7 %
:RPS:SCOP  3->258 1k77A  c.1.15.5 * e-104 39.5 %
:HMM:SCOP  1->260 1k77A_ c.1.15.5 * 6.8e-88 39.2 %
:RPS:PFM   24->217 PF01261 * AP_endonuc_2 5e-14 34.6 %
:HMM:PFM   21->219 PF01261 * AP_endonuc_2 1.2e-38 22.3 193/211  
:BLT:SWISS 1->258 HYI_ECOLI e-130 84.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69805.1 GT:GENE hyi GT:PRODUCT hydroxypyruvate isomerase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 626509..627285 GB:FROM 626509 GB:TO 627285 GB:DIRECTION + GB:GENE hyi GB:PRODUCT hydroxypyruvate isomerase GB:NOTE identified by match to protein family HMM PF01261; match to protein family HMM TIGR03234 GB:PROTEIN_ID ACF69805.1 GB:DB_XREF GI:194409586 GB:GENE:GENE hyi LENGTH 258 SQ:AASEQ MLRFSANLSMLFTEYDFLERFDKAALSGFRGVEFMFPYDNDIEVLKRKLRDNNLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPSGFSATEIHDTLVENLRYAANMLAKEDILLLIEPINHFDMPGFHLTGTQQALALIKDIGSDNIKIQYDIYHMQRMEGELTQTMTAWADKIGHLQIADNPRRGEPGTGEINYDFIFNVIKQSDYDGWVGCEYKPLTTTEAGLSWINQYR GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 1->258|HYI_ECOLI|e-130|84.5|258/258| BL:PDB:NREP 1 BL:PDB:REP 3->258|1k77A|2e-53|39.9|253/256| RP:PDB:NREP 1 RP:PDB:REP 1->254|1dxiA|7e-39|15.7|254/388| RP:PFM:NREP 1 RP:PFM:REP 24->217|PF01261|5e-14|34.6|185/200|AP_endonuc_2| HM:PFM:NREP 1 HM:PFM:REP 21->219|PF01261|1.2e-38|22.3|193/211|AP_endonuc_2| RP:SCP:NREP 1 RP:SCP:REP 3->258|1k77A|e-104|39.5|256/260|c.1.15.5| HM:SCP:REP 1->260|1k77A_|6.8e-88|39.2|260/0|c.1.15.5|1/1|Xylose isomerase-like| OP:NHOMO 534 OP:NHOMOORG 334 OP:PATTERN -------------------------------------------------------------------- --2-1--1222----------1---2------1----132----211----13111-----1----1111------------1----------1-------1-122-5-2--------------------------222---------------------------------------------1---------------------------------111-------11------------------------------------------------------------------------------------------------------------------------------11---------------1-41--------11221--11-11111111111111-1111121213--4---4345545322---2-2----211--------2---1--1-------------------------------21--111-12222222111-223222221222322221222221-11212122111-----1----------111---------1---1---------------------------------------------1--11---1-1-----------------------------------1--12112232322-12222222-212122222-1231111-2122112222222222212--1-2--111111111111--------------1111---1-1--1-111111111111---3-22221213211122221----------1--1-----1-----------------------------------------------------------------------111-2- ------1--------------------------------------------111------------------------------------------------------3-2111-11111-111211618B1-424-1-121111-111111-11211122-121121114112----------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 100.0 SQ:SECSTR HHHHTcccccccccccHHHHHHHHHHHTccEEEEEHHHHHHHHHHHHHHHHHTccccEEEccccccGGGccccTTcccHHHHHHHHHHHHHHHHHTTTccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHTTccEEEcccccccccEEccccHHHHHHHHTTcccGGTcccccHHHHHTTTccHHHHHHHTTTccccEEEccccccccTcccHHHHHHHHHHHHHTTccccEEEcccccTTccHHHHHHHHHH DISOP:02AL 1-1| PSIPRED ccEEEEEHHHHcccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHccHHHHHHHHHHcccccEEEEEcHHHHHHccccHHHHHHHHHccEEEEEEEccccccccccccccHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHcc //