[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : icd
DDBJ      :icd          isocitrate dehydrogenase, NADP-dependent
Swiss-Prot:IDH_ECOLI    RecName: Full=Isocitrate dehydrogenase [NADP];         Short=IDH;         EC=1.1.1.42;AltName: Full=Oxalosuccinate decarboxylase;AltName: Full=NADP(+)-specific ICDH;AltName: Full=IDP;

Homologs  Archaea  59/68 : Bacteria  703/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.77.1
:416 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->416 1p8fA PDBj 0.0 96.9 %
:RPS:PDB   2->416 1cw7A PDBj e-128 93.7 %
:RPS:SCOP  3->416 1ai2A  c.77.1.1 * e-126 94.0 %
:HMM:SCOP  1->416 1pb1A_ c.77.1.1 * 4.2e-149 45.2 %
:RPS:PFM   28->412 PF00180 * Iso_dh 4e-78 53.7 %
:HMM:PFM   29->412 PF00180 * Iso_dh 9e-117 39.6 338/347  
:BLT:SWISS 1->416 IDH_ECOLI 0.0 96.9 %
:PROS 303->322|PS00470|IDH_IMDH
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68045.1 GT:GENE icd GT:PRODUCT isocitrate dehydrogenase, NADP-dependent GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1328725..1329975 GB:FROM 1328725 GB:TO 1329975 GB:DIRECTION + GB:GENE icd GB:PRODUCT isocitrate dehydrogenase, NADP-dependent GB:NOTE identified by match to protein family HMM PF00180; match to protein family HMM TIGR00183 GB:PROTEIN_ID ACF68045.1 GB:DB_XREF GI:194407826 GB:GENE:GENE icd LENGTH 416 SQ:AASEQ MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGAFKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMDGAKLLKCSEFGDAIIANM GT:EXON 1|1-416:0| SW:ID IDH_ECOLI SW:DE RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; EC=1.1.1.42;AltName: Full=Oxalosuccinate decarboxylase;AltName: Full=NADP(+)-specific ICDH;AltName: Full=IDP; SW:GN Name=icd; Synonyms=icdA, icdE; OrderedLocusNames=b1136, JW1122; SW:KW 3D-structure; Acetylation; Complete proteome;Direct protein sequencing; Glyoxylate bypass; Magnesium; Manganese;Metal-binding; NADP; Oxidoreductase; Phosphoprotein;Tricarboxylic acid cycle. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->416|IDH_ECOLI|0.0|96.9|416/416| GO:SWS:NREP 5 GO:SWS GO:0006097|"GO:glyoxylate cycle"|Glyoxylate bypass| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| PROS 303->322|PS00470|IDH_IMDH|PDOC00389| SEG 318->329|ggigiapganig| BL:PDB:NREP 1 BL:PDB:REP 1->416|1p8fA|0.0|96.9|416/416| RP:PDB:NREP 1 RP:PDB:REP 2->416|1cw7A|e-128|93.7|415/415| RP:PFM:NREP 1 RP:PFM:REP 28->412|PF00180|4e-78|53.7|335/338|Iso_dh| HM:PFM:NREP 1 HM:PFM:REP 29->412|PF00180|9e-117|39.6|338/347|Iso_dh| GO:PFM:NREP 4 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00180|IPR001804| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00180|IPR001804| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00180|IPR001804| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00180|IPR001804| RP:SCP:NREP 1 RP:SCP:REP 3->416|1ai2A|e-126|94.0|414/414|c.77.1.1| HM:SCP:REP 1->416|1pb1A_|4.2e-149|45.2|416/0|c.77.1.1|1/1|Isocitrate/Isopropylmalate dehydrogenase-like| OP:NHOMO 1921 OP:NHOMOORG 946 OP:PATTERN 11-2--2222222222-2222222211222222222222222222222323332221----3112-22 343211111111111--11-11--12111111-3332243---12-1-111112-1-1--111-13211111111111-12-3221211121-1---1---2-1111-31--------------1111111111213332222143222222222222222221222223212212112222233322--132222222211212122122333211232332112222222212221222222222222211-------2-------------1-221-------211-1111111111-------------222111222-23-211111111-1122--1---2--1-31-12111-222-22--12--32221----1--1--522--2-1-1-11111111111-23422431112-222211342411-11112123133-1-2222222233311-21111111111111111111111111111111121122222325544311111333411111122545521122543344334774322222212111111122223212221212222221---11--1221111331311111------111111111-211122221211212212222222222222222222---1321-1----21321112222222122-2222211222212222222111111212111111111111112222211121-122222222222--1111111222214212---113-111-1--2333331212111221223221222212221----1---11--2------1-11221111111111112211--2222-------------------------------------22--1-1111-1 ----225-21--3333444456365653323334443333233333334433333333333332333323323332323333333313-343433343433-3556-31345833333211222221324M3-235222232234212213-163312436424332A2753363333-911123747649211111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 416 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccEEETTEEEcccccEEEEEcccTTHHHHHHHHHHHHHHHHHHHTTTccccEEEEcccTHHHHHHHcTTccccHHHHHHHHHHcEEEEcccccccccccccHHHHHHHHTTccEEEEEEEccTTcccccccGGGcEEEEEEEccccGGGccEEcTTcHHHHHHHHHHHHTcccccccccTTccEEcccccHHHHHHHHHHHHHHHHHTTccEEEEEEcTTTcTTTHHHHHHHHHHHHHHHHccEEcTTcccEEEEcTTTccEEEEEEEEHHHHHHHHHHcGGGccEEEEcHHHHHHHHHHHHHHTTcTTTcccEEEccccEEEEccccccTTTTTccccccHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHTTEEEHHHHTTccccEEEcHHHHHHHHHHTc DISOP:02AL 1-2| PSIPRED cccEEEccccccEEEEEccEEccccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHccccccccHHHHHHHHHccEEEEcccccccccccccHHHHHHHHHccEEEEEEEEEcccccccccccccccEEEEEcccccEEEccccEEccccccEEEEEccccccEEEEEcccccEEEEEEEEHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccEEEHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHcccHHHccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHcccccccccHHHHHHHHHHHc //