[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : infC
DDBJ      :infC         translation initiation factor IF-3
Swiss-Prot:IF3_SALTY    RecName: Full=Translation initiation factor IF-3;

Homologs  Archaea  0/68 : Bacteria  875/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
d.15.8d.68.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->35 1tifA PDBj 1e-08 64.7 %
:BLT:PDB   62->144 1ife- PDBj 9e-44 100.0 %
:RPS:PDB   62->144 2crqA PDBj 3e-19 18.1 %
:RPS:SCOP  1->37 1tifA  d.15.8.1 * 2e-14 64.9 %
:RPS:SCOP  62->142 1tigA  d.68.1.1 * 5e-30 47.5 %
:HMM:SCOP  1->50 1tifA_ d.15.8.1 * 1.6e-18 72.0 %
:HMM:SCOP  54->144 2ifeA_ d.68.1.1 * 3.7e-36 60.4 %
:RPS:PFM   1->39 PF05198 * IF3_N 7e-12 82.1 %
:RPS:PFM   63->140 PF00707 * IF3_C 1e-18 61.0 %
:HMM:PFM   55->142 PF00707 * IF3_C 3.3e-38 58.6 87/88  
:HMM:PFM   1->49 PF05198 * IF3_N 2.6e-25 69.4 49/76  
:BLT:SWISS 1->144 IF3_SALTY 2e-63 99.3 %
:PROS 30->43|PS00938|IF3
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68680.1 GT:GENE infC GT:PRODUCT translation initiation factor IF-3 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1419285..1419719 GB:FROM 1419285 GB:TO 1419719 GB:DIRECTION + GB:GENE infC GB:PRODUCT translation initiation factor IF-3 GB:NOTE identified by match to protein family HMM PF00707; match to protein family HMM TIGR00168 GB:PROTEIN_ID ACF68680.1 GB:DB_XREF GI:194408461 GB:GENE:GENE infC LENGTH 144 SQ:AASEQ MSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFPTKIEGRQMIMVLAPKKKQ GT:EXON 1|1-144:0| SW:ID IF3_SALTY SW:DE RecName: Full=Translation initiation factor IF-3; SW:GN Name=infC; OrderedLocusNames=STM1334; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|IF3_SALTY|2e-63|99.3|144/180| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 30->43|PS00938|IF3|PDOC00723| SEG 40->61|eksksskeqkkkqkviqvkeik| BL:PDB:NREP 2 BL:PDB:REP 2->35|1tifA|1e-08|64.7|34/76| BL:PDB:REP 62->144|1ife-|9e-44|100.0|83/91| RP:PDB:NREP 1 RP:PDB:REP 62->144|2crqA|3e-19|18.1|83/112| RP:PFM:NREP 2 RP:PFM:REP 1->39|PF05198|7e-12|82.1|39/74|IF3_N| RP:PFM:REP 63->140|PF00707|1e-18|61.0|77/87|IF3_C| HM:PFM:NREP 2 HM:PFM:REP 55->142|PF00707|3.3e-38|58.6|87/88|IF3_C| HM:PFM:REP 1->49|PF05198|2.6e-25|69.4|49/76|IF3_N| GO:PFM:NREP 4 GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF05198|IPR019814| GO:PFM GO:0006413|"GO:translational initiation"|PF05198|IPR019814| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF00707|IPR019815| GO:PFM GO:0006413|"GO:translational initiation"|PF00707|IPR019815| RP:SCP:NREP 2 RP:SCP:REP 1->37|1tifA|2e-14|64.9|37/76|d.15.8.1| RP:SCP:REP 62->142|1tigA|5e-30|47.5|80/88|d.68.1.1| HM:SCP:REP 1->50|1tifA_|1.6e-18|72.0|50/76|d.15.8.1|1/1|Translation initiation factor IF3, N-terminal domain| HM:SCP:REP 54->144|2ifeA_|3.7e-36|60.4|91/0|d.68.1.1|1/1|Translation initiation factor IF3, C-terminal domain| OP:NHOMO 911 OP:NHOMOORG 893 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111211111111111111111112221111111111111111111111111111111111111111111-111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111211111111111111111111111111111111111111111-111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111--1111111111111111111-11-11-111----1--11111-11111111111111111111111111111111-11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111-111-1--11-11--1----1111111111111 ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------2--1-11117111113--1-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 81.2 SQ:SECSTR #EHHHHHHHHHHTTcEEEEEETTccccEEEEEcHH##########################EETTccHHHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHTTcTTTcEEEEEEEEEGGTEEEEEEEccccc DISOP:02AL 1-1,38-57,143-145| PSIPRED ccHHHHHHHHHHccccEEEEcccccccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHEEcccccccccEEEEEEEEcccc //