[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : kdpC
DDBJ      :kdpC         K+-transporting ATPase, C subunit
Swiss-Prot:ATKC_SALHS   RecName: Full=Potassium-transporting ATPase C chain;         EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase C chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] C chain;AltName: Full=Potassium-binding and translocating subunit C;

Homologs  Archaea  5/68 : Bacteria  379/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->188 PF02669 * KdpC 1e-39 60.6 %
:HMM:PFM   3->187 PF02669 * KdpC 5.8e-89 58.9 185/188  
:BLT:SWISS 1->194 ATKC_SALHS 9e-97 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67701.1 GT:GENE kdpC GT:PRODUCT K+-transporting ATPase, C subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(818115..818699) GB:FROM 818115 GB:TO 818699 GB:DIRECTION - GB:GENE kdpC GB:PRODUCT K+-transporting ATPase, C subunit GB:NOTE identified by match to protein family HMM PF02669; match to protein family HMM TIGR00681 GB:PROTEIN_ID ACF67701.1 GB:DB_XREF GI:194407482 GB:GENE:GENE kdpC LENGTH 194 SQ:AASEQ MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIHKDNVIRGSALIGQSFTAAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQARVAALRAANPQASSAVPVELATASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVAEYTHRPLASFLGQPVVNIVELNLALDALQGHRAK GT:EXON 1|1-194:0| SW:ID ATKC_SALHS SW:DE RecName: Full=Potassium-transporting ATPase C chain; EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase C chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] C chain;AltName: Full=Potassium-binding and translocating subunit C; SW:GN Name=kdpC; OrderedLocusNames=SeHA_C0826; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Ion transport; Membrane; Nucleotide-binding; Potassium;Potassium transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->194|ATKC_SALHS|9e-97|100.0|194/194| GO:SWS:NREP 10 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006813|"GO:potassium ion transport"|Potassium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 4->26| SEG 10->27|tmlflllltggvyplltt| RP:PFM:NREP 1 RP:PFM:REP 29->188|PF02669|1e-39|60.6|160/188|KdpC| HM:PFM:NREP 1 HM:PFM:REP 3->187|PF02669|5.8e-89|58.9|185/188|KdpC| GO:PFM:NREP 3 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02669|IPR003820| GO:PFM GO:0008556|"GO:potassium-transporting ATPase activity"|PF02669|IPR003820| GO:PFM GO:0016020|"GO:membrane"|PF02669|IPR003820| OP:NHOMO 410 OP:NHOMOORG 385 OP:PATTERN -------------------------11----------------11------------------1---- 11111------1--1--11-1----111111-11111111-11-11---11--11--1-----11-1111----------1---1---1111-1-----1-11--111-1------------------1---------------1--1--111--11------11-1322--------------11-----1--111111111111111------111-1-1-1121111111-22111111122211--11-1------------------------------------------------------------------------1--------1-1-111--1-----------------------1----1--111------111111-111111----------1-11-11111-11-11111111111111------1-11---2222222221--1111--------------------------------1--1111-1111111111111111111112111111-1111-11--11--1-111--1111------------1--------11-111-1--1111---1--11--------111----------------22111-------------------1----1--------1------11111111111111111-11111111111111111111111111-11111111111111111--1-1111-111111111111-------------1-------------------1111111-----11211111-1111-111111111111---------------1111111111------------11----------------------------------------------1-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,81-81,83-84,191-195| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcc //