[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : kpdD
DDBJ      :kpdD         4-hydroxybenzoate decarboxylase, subunit D
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->38 PF06353 * DUF1062 2.4e-05 47.1 17/142  
:BLT:SWISS 3->70 BSDD_BACSU 3e-16 47.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65843.1 GT:GENE kpdD GT:PRODUCT 4-hydroxybenzoate decarboxylase, subunit D GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 3039818..3040054 GB:FROM 3039818 GB:TO 3040054 GB:DIRECTION + GB:GENE kpdD GB:PRODUCT 4-hydroxybenzoate decarboxylase, subunit D GB:PROTEIN_ID ACF65843.1 GB:DB_XREF GI:194405624 GB:GENE:GENE kpdD LENGTH 78 SQ:AASEQ MICPRCADAHIELMATSPVKGVWTVYQCQHCLYTWRDTEPLRRTSREHYPQAFRMTQKDIDDAPMVPSIPPLLAEDKR GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 3->70|BSDD_BACSU|3e-16|47.1|68/100| HM:PFM:NREP 1 HM:PFM:REP 22->38|PF06353|2.4e-05|47.1|17/142|DUF1062| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------1-----------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------11-----1--1--111-1111-1-----11111----1111111111111111---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,7-7,76-79| PSIPRED ccccccccccccEEEcccccccEEEEEEcEEEEEEEcccccccccHHHccHHHcccHHHHHHHccccccccHHHcccc //