[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : lspA
DDBJ      :lspA         signal peptidase II
Swiss-Prot:LSPA_SALTY   RecName: Full=Lipoprotein signal peptidase;         EC=3.4.23.36;AltName: Full=Prolipoprotein signal peptidase;AltName: Full=Signal peptidase II;         Short=SPase II;

Homologs  Archaea  0/68 : Bacteria  559/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->163 PF01252 * Peptidase_A8 5e-29 48.6 %
:HMM:PFM   15->157 PF01252 * Peptidase_A8 1.3e-46 37.3 142/150  
:BLT:SWISS 1->166 LSPA_SALTY 3e-88 100.0 %
:PROS 104->116|PS00855|SPASE_II
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67840.1 GT:GENE lspA GT:PRODUCT signal peptidase II GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 52146..52646 GB:FROM 52146 GB:TO 52646 GB:DIRECTION + GB:GENE lspA GB:PRODUCT signal peptidase II GB:NOTE identified by match to protein family HMM PF01252; match to protein family HMM TIGR00077 GB:PROTEIN_ID ACF67840.1 GB:DB_XREF GI:194407621 GB:GENE:GENE lspA LENGTH 166 SQ:AASEQ MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA GT:EXON 1|1-166:0| SW:ID LSPA_SALTY SW:DE RecName: Full=Lipoprotein signal peptidase; EC=3.4.23.36;AltName: Full=Prolipoprotein signal peptidase;AltName: Full=Signal peptidase II; Short=SPase II; SW:GN Name=lspA; OrderedLocusNames=STM0047; SW:KW Aspartyl protease; Cell inner membrane; Cell membrane;Complete proteome; Hydrolase; Membrane; Protease; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->166|LSPA_SALTY|3e-88|100.0|166/166| GO:SWS:NREP 7 GO:SWS GO:0004190|"GO:aspartic-type endopeptidase activity"|Aspartyl protease| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 104->116|PS00855|SPASE_II|PDOC00669| TM:NTM 4 TM:REGION 7->29| TM:REGION 68->89| TM:REGION 95->117| TM:REGION 138->160| SEG 10->20|lrwlwlvvvvl| RP:PFM:NREP 1 RP:PFM:REP 21->163|PF01252|5e-29|48.6|140/149|Peptidase_A8| HM:PFM:NREP 1 HM:PFM:REP 15->157|PF01252|1.3e-46|37.3|142/150|Peptidase_A8| GO:PFM:NREP 3 GO:PFM GO:0004190|"GO:aspartic-type endopeptidase activity"|PF01252|IPR001872| GO:PFM GO:0006508|"GO:proteolysis"|PF01252|IPR001872| GO:PFM GO:0016020|"GO:membrane"|PF01252|IPR001872| OP:NHOMO 621 OP:NHOMOORG 561 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------11-1------------------------1111----1111---111------2----111---11-1111---------1111--1-----------1--------1--1111111111111111-111111111-1-1111112111-1111111111111111---1-11-11-111111--1111----111---1---111-----------111111111111111----11111121-------------111---1111---------1--111-1111-1111--11-1-1-1-1----------111111111111---------311-111111111111--1112-1-----1-11111111-11--111111-1---11--1111111111111-1-1-111-111111111111111111111111111118111311221111322111114151111111111111111113111111111-11111111111212--1-3111-----111111--------------111111511411111111121311411113111-1111211-11111111111111111111-11111111111111111111121111111111111111111111111111111111111111111111111111111112111111111111-111113121311121111112111111112111111111111111111111111111111111111111111111-----------------------------------------------------11- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,156-167| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEEEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccHHccc //