[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : maiA
DDBJ      :maiA         maleylacetoacetate isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  240/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->210 2v6kA PDBj 6e-41 42.1 %
:RPS:PDB   1->199 3einA PDBj 1e-31 18.4 %
:RPS:SCOP  1->137 1i9dA  c.47.1.12 * 6e-21 9.9 %
:RPS:SCOP  111->208 1tw9A1  a.45.1.1 * 2e-14 18.6 %
:HMM:SCOP  1->90 1jlwA2 c.47.1.5 * 2.9e-24 38.9 %
:HMM:SCOP  81->215 1e6bA1 a.45.1.1 * 1.6e-30 33.3 %
:RPS:PFM   14->73 PF02798 * GST_N 7e-09 44.1 %
:HMM:PFM   1->75 PF02798 * GST_N 6e-11 35.2 71/75  
:HMM:PFM   139->198 PF00043 * GST_C 2.1e-08 29.8 57/95  
:BLT:SWISS 3->210 MAAI_VIBCH 6e-47 46.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68983.1 GT:GENE maiA GT:PRODUCT maleylacetoacetate isomerase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2320567..2321211) GB:FROM 2320567 GB:TO 2321211 GB:DIRECTION - GB:GENE maiA GB:PRODUCT maleylacetoacetate isomerase GB:NOTE identified by match to protein family HMM PF02798; match to protein family HMM TIGR01262 GB:PROTEIN_ID ACF68983.1 GB:DB_XREF GI:194408764 GB:GENE:GENE maiA LENGTH 214 SQ:AASEQ MKLYSFFNSSASYRVRIALALKGIDYQTVGVNIRIGQQNALAYRRMNPVGLVPTLVTDDGESLGQSLAIVDWLDRHFPQTPLLPTSDPARSQALEIVYAIACDIHPINNMRVLRYLTDELKVREEDKKRWYAHWIQQGLSAVEQLLRKSQSGRFCVGDAPGLADCCLIPQWANALRMGCDLSGYPRCKAVYDACVQLPAFIAAAPENQQDKIPA GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 3->210|MAAI_VIBCH|6e-47|46.3|205/215| BL:PDB:NREP 1 BL:PDB:REP 1->210|2v6kA|6e-41|42.1|209/214| RP:PDB:NREP 1 RP:PDB:REP 1->199|3einA|1e-31|18.4|190/207| RP:PFM:NREP 1 RP:PFM:REP 14->73|PF02798|7e-09|44.1|59/71|GST_N| HM:PFM:NREP 2 HM:PFM:REP 1->75|PF02798|6e-11|35.2|71/75|GST_N| HM:PFM:REP 139->198|PF00043|2.1e-08|29.8|57/95|GST_C| RP:SCP:NREP 2 RP:SCP:REP 1->137|1i9dA|6e-21|9.9|131/138|c.47.1.12| RP:SCP:REP 111->208|1tw9A1|2e-14|18.6|97/114|a.45.1.1| HM:SCP:REP 1->90|1jlwA2|2.9e-24|38.9|90/90|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 81->215|1e6bA1|1.6e-30|33.3|132/133|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 549 OP:NHOMOORG 359 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------2---1111--1------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-----1-334211313211111111-11--11-11131232-2---3314331112211-12----121--------1-1---1-------------------------------12411211131222211111133211111113252331-111221211262-11--1----2-----------12-1-----------------------111122-----------------------------1112--3122-1222221122212211112---111-------1---1---11-----1--1---------1-----------11---1-11111111111111-------------------------1-----2222111-3---------------111111--122-33433213222222221-------------122222111112121211111--------11----------------------------------------------------- ----111-----11-----11111211111111211111111111111111111-1-----------------------------------------------211-1-22211211111-1112-1115B3--14111111111-12-111-11111113111112411233111--------11553-421132211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 100.0 SQ:SECSTR cEEEEcTTcHHHHHHHHHHHHHTcccEEEEccGGGTGGGcHHHHTTcTTccccEEEEETTEEEEcHHHHHHHHHHHHccccTTccccHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTHHcccccHHHHHHHHHHHHHHHHHTHHHTTccccccccccHHHHHHHHHHHHHHHTTccGGGcHHHHHHHHHHHHHcTHHHHHHHcccccccG DISOP:02AL 212-215| PSIPRED cEEEEccccHHHHHHHHHHHHcccccEEEEccccccccccHHHHHccccccccEEEEcccEEEEEHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHccHHHHHHccHHccccccc //