[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : map
DDBJ      :map          methionine aminopeptidase, type I
Swiss-Prot:AMPM_SALTY   RecName: Full=Methionine aminopeptidase;         Short=MAP;         EC=3.4.11.18;AltName: Full=Peptidase M;

Homologs  Archaea  43/68 : Bacteria  907/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
d.127.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->264 2gg2A PDBj e-140 89.4 %
:RPS:PDB   5->262 2bb7A PDBj 2e-71 89.1 %
:RPS:SCOP  2->263 1c21A  d.127.1.1 * 3e-70 88.9 %
:HMM:SCOP  2->256 1c22A_ d.127.1.1 * 7.5e-88 42.7 %
:RPS:PFM   13->205 PF00557 * Peptidase_M24 3e-29 41.8 %
:HMM:PFM   12->242 PF00557 * Peptidase_M24 5.6e-51 36.5 203/203  
:BLT:SWISS 1->264 AMPM_SALTY e-156 100.0 %
:PROS 168->186|PS00680|MAP_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67452.1 GT:GENE map GT:PRODUCT methionine aminopeptidase, type I GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(260788..261582) GB:FROM 260788 GB:TO 261582 GB:DIRECTION - GB:GENE map GB:PRODUCT methionine aminopeptidase, type I GB:NOTE identified by match to protein family HMM PF00557; match to protein family HMM TIGR00500 GB:PROTEIN_ID ACF67452.1 GB:DB_XREF GI:194407233 GB:GENE:GENE map LENGTH 264 SQ:AASEQ MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE GT:EXON 1|1-264:0| SW:ID AMPM_SALTY SW:DE RecName: Full=Methionine aminopeptidase; Short=MAP; EC=3.4.11.18;AltName: Full=Peptidase M; SW:GN Name=map; Synonyms=pepM; OrderedLocusNames=STM0215; SW:KW Aminopeptidase; Cobalt; Complete proteome; Direct protein sequencing;Hydrolase; Metal-binding; Protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->264|AMPM_SALTY|e-156|100.0|264/264| GO:SWS:NREP 4 GO:SWS GO:0004177|"GO:aminopeptidase activity"|Aminopeptidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 168->186|PS00680|MAP_1|PDOC00575| BL:PDB:NREP 1 BL:PDB:REP 2->264|2gg2A|e-140|89.4|263/263| RP:PDB:NREP 1 RP:PDB:REP 5->262|2bb7A|2e-71|89.1|258/258| RP:PFM:NREP 1 RP:PFM:REP 13->205|PF00557|3e-29|41.8|182/203|Peptidase_M24| HM:PFM:NREP 1 HM:PFM:REP 12->242|PF00557|5.6e-51|36.5|203/203|Peptidase_M24| GO:PFM:NREP 1 GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 1 RP:SCP:REP 2->263|1c21A|3e-70|88.9|262/263|d.127.1.1| HM:SCP:REP 2->256|1c22A_|7.5e-88|42.7|255/262|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 2049 OP:NHOMOORG 1144 OP:PATTERN 112-11--1111111-111111--1----------11------11111211-1-32333331111-11 1231334233333242233-33222433333244343443121332323223433224113332524444211111111132122121222212111--1121113221222222221221111111221122112222121112212312222211111111231222221112111112111312211222366666666466666641333366743334231111116423333333333333333321212111112121111112211222222222122222222222222222222222222222222222222223213444444434324332333321113221222232221211112211211111211111112221111112111111111115-222221221121233222222232212221131111111111111111111112111111122111111111111111111111111211111112223222222222222222222231111111111111122122112112112111111111111122121323221311222221111114323222111-1111111111111111111111111111121121111111122222111211121-1111111111111111211111111111-11122211211111111113231121211111111111111112221111111222222211222111111111222221312111111111111111332332211112222222222122213221111111111111111111111112231311221111111122211111111111111111112-22222111112211221111122111111111 3311233-511-2221121222122222211111111111111111111111111111111111111111111111111111111111-14212322222211333-24232322322223222442223A21224222232242222112123122221112222-223211232224X3232275751542463344 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 100.0 SQ:SECSTR cccccccHHHHHHHHHHHHHHHHHHHHHGGGccTTccHHHHHHHHHHHHHHTcccEEccTTGGGcccccEEEETTEEEcccccTTccccTTcEEEEEEEEEETTEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHTTcEEcccccEEEccccccEEEEEcccccTTccccccTTcEEEEccEEEcccccEEEcTTcccEEETTcccEEEccEEEEEcccEEEETTccTTcccccEEEccH DISOP:02AL 264-265| PSIPRED cEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEccccEEEEcccEEcccccEEEcccccEEEcccccEEEEEEEEEEEcccccEEcccccHHHHHHHHHccc //