[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : menB
DDBJ      :menB         naphthoate synthase
Swiss-Prot:MENB_ECOLI   RecName: Full=Naphthoate synthase;         EC=4.1.3.36;AltName: Full=Dihydroxynaphthoic acid synthetase;         Short=DHNA synthetase;

Homologs  Archaea  34/68 : Bacteria  647/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->285 3h02A PDBj e-136 100.0 %
:RPS:PDB   21->283 1dciA PDBj 9e-58 23.3 %
:RPS:SCOP  25->278 1uiyA  c.14.1.3 * 1e-65 32.9 %
:HMM:SCOP  4->285 1q52A_ c.14.1.3 * 8.2e-76 35.6 %
:RPS:PFM   35->205 PF00378 * ECH 2e-31 42.6 %
:HMM:PFM   35->206 PF00378 * ECH 2.8e-57 36.5 170/170  
:HMM:PFM   195->224 PF07891 * DUF1666 0.00072 30.0 30/246  
:BLT:SWISS 1->285 MENB_ECOLI e-167 96.8 %
:PROS 123->143|PS00166|ENOYL_COA_HYDRATASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68156.1 GT:GENE menB GT:PRODUCT naphthoate synthase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2461561..2462418) GB:FROM 2461561 GB:TO 2462418 GB:DIRECTION - GB:GENE menB GB:PRODUCT naphthoate synthase GB:NOTE identified by match to protein family HMM PF00378; match to protein family HMM TIGR01929 GB:PROTEIN_ID ACF68156.1 GB:DB_XREF GI:194407937 GB:GENE:GENE menB LENGTH 285 SQ:AASEQ MIYPDETMLYAPVEWHDCSEGYTDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNVGVIILTGEGDKAFCAGGDQKVRGDYGGYQDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP GT:EXON 1|1-285:0| SW:ID MENB_ECOLI SW:DE RecName: Full=Naphthoate synthase; EC=4.1.3.36;AltName: Full=Dihydroxynaphthoic acid synthetase; Short=DHNA synthetase; SW:GN Name=menB; OrderedLocusNames=b2262, JW2257; SW:KW Complete proteome; Lyase; Menaquinone biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->285|MENB_ECOLI|e-167|96.8|285/285| GO:SWS:NREP 2 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0009234|"GO:menaquinone biosynthetic process"|Menaquinone biosynthesis| PROS 123->143|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| BL:PDB:NREP 1 BL:PDB:REP 5->285|3h02A|e-136|100.0|255/255| RP:PDB:NREP 1 RP:PDB:REP 21->283|1dciA|9e-58|23.3|262/275| RP:PFM:NREP 1 RP:PFM:REP 35->205|PF00378|2e-31|42.6|169/170|ECH| HM:PFM:NREP 2 HM:PFM:REP 35->206|PF00378|2.8e-57|36.5|170/170|ECH| HM:PFM:REP 195->224|PF07891|0.00072|30.0|30/246|DUF1666| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 25->278|1uiyA|1e-65|32.9|249/253|c.14.1.3| HM:SCP:REP 4->285|1q52A_|8.2e-76|35.6|281/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4586 OP:NHOMOORG 845 OP:PATTERN 22-1--3987988974-121211A63432346-----------------------------2331-11 2444C325113442HVNAA-AO55JY99999GRPVPFNfk1M2L212411115454431198G18CBB685--------1518-----1111-1211--31222354322--------------11111121112154455---3721111111111111111111-112111111111111123123---7526666655757575554655347755BA86411111119-111111111111111111111-1----1-----11---1-111111---1111111-----------11111111111111--111---2--1131111111212-2221221-211-3-11-561427-15---1--1-2--C66E-1---4-PFH314NHKHD67766675776-33833F5879Q-6333459868A89A7F6798457766F--------522-1B84-----------------------------1CHWA-3cSDMADFCJB6565499CB877637FAWKXbR23EE8766BBE9GDHN228----54----------H8A5UA71---------17872E13--3523A452---------------------------231251625434544444633355574456---1-1-------21232125335543466-365643354534344544533411222232322222222223243323333--211111111111---1222221111-4523111111111111111AA99A296754176676856487987444----------121711111351432232322333-------1553322-----------------------------------------------11 ----664-422-437B964977AA5957746456757B787776455669A9FA574353234--------------------------55394431221317667-774IB988A654647A1H83A2QtF-Q7B2253945A81577-832B3575C8A64F764754BBA683231N23244978G6452456643 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 100.0 SQ:SECSTR HHHHHcEETTTTEEcEEEccccccEEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHTcTTccEEEEEEcTcTcccccccHHHHHHHHTccccccHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEccGGGGTccccccHHHHGGGTccHHHHHHHHHHccEEEHHHHHHHTcccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTccHHHHHHHHHHHTTccGGGcccccHH DISOP:02AL 1-2,279-280,282-282| PSIPRED cccccHHHHccccccccccccccEEEEEEEcccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEccccccEEccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccc //