[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mepA
DDBJ      :mepA         penicillin-insensitive murein endopeptidase
Swiss-Prot:MEPA_SALHS   RecName: Full=Penicillin-insensitive murein endopeptidase;         EC=3.4.24.-;AltName: Full=D-alanyl-D-alanine-endopeptidase;         Short=DD-endopeptidase;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.65.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->274 1tzpA PDBj e-124 87.1 %
:RPS:SCOP  20->274 1tzpA  d.65.1.3 * e-100 87.1 %
:HMM:SCOP  20->274 1tzpA_ d.65.1.3 * 1.5e-100 53.3 %
:RPS:PFM   36->270 PF03411 * Peptidase_M74 2e-73 59.6 %
:HMM:PFM   35->273 PF03411 * Peptidase_M74 1e-135 64.4 239/240  
:BLT:SWISS 1->274 MEPA_SALHS e-150 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70200.1 GT:GENE mepA GT:PRODUCT penicillin-insensitive murein endopeptidase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2538484..2539308) GB:FROM 2538484 GB:TO 2539308 GB:DIRECTION - GB:GENE mepA GB:PRODUCT penicillin-insensitive murein endopeptidase GB:NOTE identified by match to protein family HMM PF03411 GB:PROTEIN_ID ACF70200.1 GB:DB_XREF GI:194409981 GB:GENE:GENE mepA LENGTH 274 SQ:AASEQ MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSIGSFANGCIIGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAQQRGLGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASLIKLAAQDNDVTRIFVNPAIKQQLCLDAGSDRGWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL GT:EXON 1|1-274:0| SW:ID MEPA_SALHS SW:DE RecName: Full=Penicillin-insensitive murein endopeptidase; EC=3.4.24.-;AltName: Full=D-alanyl-D-alanine-endopeptidase; Short=DD-endopeptidase;Flags: Precursor; SW:GN Name=mepA; OrderedLocusNames=SeHA_C2625; SW:KW Complete proteome; Disulfide bond; Hydrolase; Metal-binding;Metalloprotease; Periplasm; Protease; Signal; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|MEPA_SALHS|e-150|100.0|274/274| GO:SWS:NREP 5 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| SEG 245->263|ppkpgttkpekktppplpp| BL:PDB:NREP 1 BL:PDB:REP 20->274|1tzpA|e-124|87.1|240/240| RP:PFM:NREP 1 RP:PFM:REP 36->270|PF03411|2e-73|59.6|235/238|Peptidase_M74| HM:PFM:NREP 1 HM:PFM:REP 35->273|PF03411|1e-135|64.4|239/240|Peptidase_M74| GO:PFM:NREP 3 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF03411|IPR005073| GO:PFM GO:0006508|"GO:proteolysis"|PF03411|IPR005073| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03411|IPR005073| RP:SCP:NREP 1 RP:SCP:REP 20->274|1tzpA|e-100|87.1|240/240|d.65.1.3| HM:SCP:REP 20->274|1tzpA_|1.5e-100|53.3|255/255|d.65.1.3|1/1|Hedgehog/DD-peptidase| OP:NHOMO 167 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-1111121111--11111111111111---1111111111------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------1------11--1-------------11111111111111111-111111111111111111111111---111111111111111111111111--111111111111-------------1----111111111111111------------------------------------------1-----11111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 88.0 SQ:SECSTR ###################ccHHHHcccccccccEEEEETTEEEEEccEEcccccccEEEccGGGcccEEcHHHHHHHHHHHHHHHHTTcccEEEcccccTTcccccccccccccccEEEEEcccccccccHHHHHcccccccccTTcccccTTTccHHHHHHHHHHHHcTTEEEEEEcHHHHHHHHHHcTTccGGGGGEEEccccccEEEEEEcccTTcTTccccccccccccTTHHHHHTTc##############ccccHHHHHHHHTTcc DISOP:02AL 1-2,28-36,132-140,221-232,246-261,274-275| PSIPRED cHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccccccccEEcccccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHccccEEEEEccccccccHHHcccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEcHHHHHHHHccccccHHHHHHcccccccccEEEEEEEcccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHccc //