[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : metG
DDBJ      :metG         methionyl tRNA synthetase
Swiss-Prot:SYM_SALTY    RecName: Full=Methionyl-tRNA synthetase;         EC=6.1.1.10;AltName: Full=Methionine--tRNA ligase;         Short=MetRS;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  196/199 : Viruses  1/175   --->[See Alignment]
a.27.1b.40.4c.26.1
:677 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->539 1pfwA PDBj 0.0 95.7 %
:BLT:PDB   571->676 1pybA PDBj 1e-20 49.5 %
:RPS:PDB   6->534 2d54A PDBj 6e-75 23.0 %
:RPS:PDB   569->676 2cwpA PDBj 4e-31 30.8 %
:RPS:SCOP  5->389 1f4lA2  c.26.1.1 * 3e-62 95.1 %
:RPS:SCOP  390->539 1f4lA1  a.27.1.1 * 2e-30 91.3 %
:RPS:SCOP  569->676 1pxfA  b.40.4.4 * 4e-32 29.9 %
:HMM:SCOP  4->389 1qqtA2 c.26.1.1 * 1.3e-105 34.1 %
:HMM:SCOP  390->549 1qqtA1 a.27.1.1 * 6.9e-47 38.1 %
:HMM:SCOP  570->676 1gd7A_ b.40.4.4 * 1.6e-33 51.9 %
:RPS:PFM   9->398 PF09334 * tRNA-synt_1g 1e-93 48.8 %
:RPS:PFM   429->522 PF08264 * Anticodon_1 2e-08 36.6 %
:RPS:PFM   581->673 PF01588 * tRNA_bind 1e-08 42.9 %
:HMM:PFM   8->397 PF09334 * tRNA-synt_1g 1.8e-159 45.6 388/391  
:HMM:PFM   581->674 PF01588 * tRNA_bind 2.1e-24 37.6 93/95  
:HMM:PFM   424->530 PF08264 * Anticodon_1 4.1e-06 21.1 95/152  
:BLT:SWISS 1->677 SYM_SALTY 0.0 99.1 %
:PROS 15->26|PS00178|AA_TRNA_LIGASE_I
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67264.1 GT:GENE metG GT:PRODUCT methionyl tRNA synthetase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2297327..2299360 GB:FROM 2297327 GB:TO 2299360 GB:DIRECTION + GB:GENE metG GB:PRODUCT methionyl tRNA synthetase GB:NOTE identified by match to protein family HMM PF01588; match to protein family HMM PF09334; match to protein family HMM TIGR00398; match to protein family HMM TIGR00399 GB:PROTEIN_ID ACF67264.1 GB:DB_XREF GI:194407045 GB:GENE:GENE metG LENGTH 677 SQ:AASEQ MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSDENRELSELIYTRLKENGFIKNRTISQLYDPEKGMFLPDRFVKGTCPKCKSADQYGDNCEVCGATYSPTELIEPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFGFEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSDAELYHFIGKDIVYFHSLFWPAMLEGSHFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLKHFDADSLRYYYTAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLAAELADPQLYKTFTDAAAVIGEAWESREFGKAIREIMALADIANRYVDEQAPWVVAKQEGRDADLQAICSMGINLFRVLMTYLKPVLPTLSERVEAFLNSELNWDAIEQPLLGHKVNTFKALYNRIDMKQVEALVEASKEEVKAAAAPVTGPLADFPIQETITFDDFAKIDLRVALIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIRSAYPDPQALIGRQTVMVANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQVK GT:EXON 1|1-677:0| SW:ID SYM_SALTY SW:DE RecName: Full=Methionyl-tRNA synthetase; EC=6.1.1.10;AltName: Full=Methionine--tRNA ligase; Short=MetRS; SW:GN Name=metG; OrderedLocusNames=STM2155; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Metal-binding; Nucleotide-binding; Protein biosynthesis;RNA-binding; tRNA-binding; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->677|SYM_SALTY|0.0|99.1|677/677| GO:SWS:NREP 9 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 15->26|PS00178|AA_TRNA_LIGASE_I|PDOC00161| SEG 540->558|vealveaskeevkaaaapv| BL:PDB:NREP 2 BL:PDB:REP 5->539|1pfwA|0.0|95.7|535/546| BL:PDB:REP 571->676|1pybA|1e-20|49.5|103/107| RP:PDB:NREP 2 RP:PDB:REP 6->534|2d54A|6e-75|23.0|486/500| RP:PDB:REP 569->676|2cwpA|4e-31|30.8|107/109| RP:PFM:NREP 3 RP:PFM:REP 9->398|PF09334|1e-93|48.8|361/363|tRNA-synt_1g| RP:PFM:REP 429->522|PF08264|2e-08|36.6|82/153|Anticodon_1| RP:PFM:REP 581->673|PF01588|1e-08|42.9|91/100|tRNA_bind| HM:PFM:NREP 3 HM:PFM:REP 8->397|PF09334|1.8e-159|45.6|388/391|tRNA-synt_1g| HM:PFM:REP 581->674|PF01588|2.1e-24|37.6|93/95|tRNA_bind| HM:PFM:REP 424->530|PF08264|4.1e-06|21.1|95/152|Anticodon_1| GO:PFM:NREP 13 GO:PFM GO:0000166|"GO:nucleotide binding"|PF09334|IPR015413| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF09334|IPR015413| GO:PFM GO:0005524|"GO:ATP binding"|PF09334|IPR015413| GO:PFM GO:0005737|"GO:cytoplasm"|PF09334|IPR015413| GO:PFM GO:0006412|"GO:translation"|PF09334|IPR015413| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF09334|IPR015413| GO:PFM GO:0000166|"GO:nucleotide binding"|PF08264|IPR013155| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF08264|IPR013155| GO:PFM GO:0005524|"GO:ATP binding"|PF08264|IPR013155| GO:PFM GO:0005737|"GO:cytoplasm"|PF08264|IPR013155| GO:PFM GO:0006412|"GO:translation"|PF08264|IPR013155| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF08264|IPR013155| GO:PFM GO:0000049|"GO:tRNA binding"|PF01588|IPR002547| RP:SCP:NREP 3 RP:SCP:REP 5->389|1f4lA2|3e-62|95.1|350/350|c.26.1.1| RP:SCP:REP 390->539|1f4lA1|2e-30|91.3|150/160|a.27.1.1| RP:SCP:REP 569->676|1pxfA|4e-32|29.9|107/111|b.40.4.4| HM:SCP:REP 4->389|1qqtA2|1.3e-105|34.1|352/352|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 390->549|1qqtA1|6.9e-47|38.1|160/160|a.27.1.1|1/1|Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases| HM:SCP:REP 570->676|1gd7A_|1.6e-33|51.9|106/109|b.40.4.4|1/1|Nucleic acid-binding proteins| OP:NHOMO 1560 OP:NHOMOORG 1173 OP:PATTERN 22221222222222222222222111121111111111111111111111111221112132123212 1121211111111111111-11111111111111111121112112111112111111114111311121111111112233222111111111111-11111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111122222221122222211221122211122121111111211111111111111111111111111111111111111111111111111111111111211211111111111111111111111111111312222111212121111222111221121111111121111111211111111111111112111111111111111111111-11111111121121112212211111122111121111111111111111111111111111111111111111111111111111111111111111111112211121222211111111111112111111111111111211121111111111111111111111111111111111111112114111111111111111111111111111111111111111111111111111111111111-1121111111111121111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111121112111111111111111111111111111111111112111111111222111-111111111311111111111111111111111111111111111111111111111111-11111111111111111111111121222111 1111232-41122221222323222222222333332222222222222222222223222232222222222222222222222212-23121212222212222132256223321111121222223E2-2232211212211211221212112222423321223B43214322L2222233342222242222 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 675 STR:RPRED 99.7 SQ:SECSTR HHTTccEEEEEEEEEETTccccHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEcccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTccccEEEETTcHHHHHHHHHHHHHHHHTTcEEEEEEEEEEETTcccccccHccccccGGGGcHHHHEEEETTTTEEEcTTTccTTccTTTccccEEEEEEEEEEcGGGGHHHHHHHHHHcTTccHHHHHHHHHHTTcccccEEcEETcccccEETTEEEEEEcHHHHHHTHHHHTTTTTTcHEEEEEEEEcHHHHHHGGGEEEEEEGGGHHHHHTHHHHHHHHHTcccccEEEEEcEEcTTcccccGGGTccccHHHHHHHHcHHHHHHHHHHHHccTTccEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcTTccccccccGGGGGGHGGHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTTcGGGGGccccccccccccccccccccETTEEEEEEEEccccHHHHHHTHHH#cHHH#HHHHHHTTccccHHHHHcccccEEEEETTcTTEEEEEcEccccEEEEEEccTTTccTGTTccTTcEEEEEccccEEETTEEEccEEcEETTEEccccTTcccccccGGGEEc DISOP:02AL 1-4,547-564,675-675,677-678| PSIPRED ccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHHHHHHHHcccEEEccEEEEccHHHccccccHHcccccccccccccccccccccccccccHHHcccccccccccEEEEEcccEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccHHHHHHccccccccccHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHcccccHHEEEEEEEEEcccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEEccccEEEEEcHHHHcccHHHHcccEEEEEEcccccHHccEEEEEEEEEEEcccccEEEEccccccccccccc //