[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : miaB
DDBJ      :miaB         tRNA-i(6)A37 thiotransferase enzyme MiaB
Swiss-Prot:MIAB_SALTY   RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB;         EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase;

Homologs  Archaea  67/68 : Bacteria  791/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.1.15c.1.28
:474 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   145->429 2qgqA PDBj 8e-20 33.6 %
:RPS:PDB   54->385 3banB PDBj 1e-56 11.2 %
:RPS:SCOP  95->361 1qtwA  c.1.15.1 * 1e-38 11.9 %
:RPS:SCOP  369->440 1yezA1  b.40.4.12 * 2e-12 17.9 %
:HMM:SCOP  97->371 1oltA_ c.1.28.2 * 4.1e-64 30.9 %
:RPS:PFM   5->103 PF00919 * UPF0004 9e-16 43.2 %
:RPS:PFM   153->319 PF04055 * Radical_SAM 6e-11 40.9 %
:RPS:PFM   381->439 PF01938 * TRAM 7e-08 52.6 %
:HMM:PFM   151->325 PF04055 * Radical_SAM 2.8e-32 35.0 160/166  
:HMM:PFM   4->104 PF00919 * UPF0004 3.1e-31 48.0 98/98  
:HMM:PFM   378->440 PF01938 * TRAM 1.4e-22 45.0 60/61  
:BLT:SWISS 1->474 MIAB_SALTY 0.0 100.0 %
:PROS 151->171|PS01278|MTTASE_RADICAL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69195.1 GT:GENE miaB GT:PRODUCT tRNA-i(6)A37 thiotransferase enzyme MiaB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(782903..784327) GB:FROM 782903 GB:TO 784327 GB:DIRECTION - GB:GENE miaB GB:PRODUCT tRNA-i(6)A37 thiotransferase enzyme MiaB GB:NOTE identified by match to protein family HMM PF00919; match to protein family HMM PF01938; match to protein family HMM PF04055; match to protein family HMM TIGR00089; match to protein family HMM TIGR01574 GB:PROTEIN_ID ACF69195.1 GB:DB_XREF GI:194408976 GB:GENE:GENE miaB LENGTH 474 SQ:AASEQ MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVIARTRKENELGVGFYQP GT:EXON 1|1-474:0| SW:ID MIAB_SALTY SW:DE RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB; EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase; SW:GN Name=miaB; OrderedLocusNames=STM0670; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; S-adenosyl-L-methionine; Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->474|MIAB_SALTY|0.0|100.0|474/474| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 151->171|PS01278|MTTASE_RADICAL|PDOC00984| BL:PDB:NREP 1 BL:PDB:REP 145->429|2qgqA|8e-20|33.6|250/266| RP:PDB:NREP 1 RP:PDB:REP 54->385|3banB|1e-56|11.2|322/349| RP:PFM:NREP 3 RP:PFM:REP 5->103|PF00919|9e-16|43.2|95/97|UPF0004| RP:PFM:REP 153->319|PF04055|6e-11|40.9|149/164|Radical_SAM| RP:PFM:REP 381->439|PF01938|7e-08|52.6|57/59|TRAM| HM:PFM:NREP 3 HM:PFM:REP 151->325|PF04055|2.8e-32|35.0|160/166|Radical_SAM| HM:PFM:REP 4->104|PF00919|3.1e-31|48.0|98/98|UPF0004| HM:PFM:REP 378->440|PF01938|1.4e-22|45.0|60/61|TRAM| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00919|IPR013848| GO:PFM GO:0009451|"GO:RNA modification"|PF00919|IPR013848| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF00919|IPR013848| GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 95->361|1qtwA|1e-38|11.9|244/285|c.1.15.1| RP:SCP:REP 369->440|1yezA1|2e-12|17.9|67/68|b.40.4.12| HM:SCP:REP 97->371|1oltA_|4.1e-64|30.9|262/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 2075 OP:NHOMOORG 964 OP:PATTERN 1121111111111111111111111111-111112322323231123221222211111111111111 2331311111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233443222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333334334333333321233212223323333332233333333333323333-3333333323212222222222223333233333333332222222222222333111222222222222222222222222221333332222222222222222222222222222222222222222222222222222222222111111122222233333333333333333333333322322233333333333333333333333333322222222212112222211122221211211111121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111122223121122222222112222222232222222222221222211112222211122121211112222211122222222222211111133333333--------32-------------------2------4334343444222 1111112-1-11111----------------------------------------------------------------------------------------111-1314822222222221242252AR3-6261221521222222221252323111523212222142523334T444442223-293352223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 455 STR:RPRED 96.0 SQ:SECSTR HHccccccccEEccEEEEEccTTccGGHHGcccccTHTccHHHHHHHHHHHHTcEEEEEEEcccTTccccHHHHHTcTTccEEEHHHHHTcEccccccTTccccHHHHHHHHHHHHHTTcEEEEEcccccHHHHHTcTTHHHHHHHHHHHHHHTccEEEEcccccccccccccccccTTcccccEEccccccccccccHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHTTcEEEEEcccccccccTTcccccccHHHHHHHHHTcccTTEEEEEEHHHHTTcTTccHHHHHEEccEEEEETTEEEEcGGGccccHHHHHHHHHHTTcEEEEEcccccccTTcccccGGGcHHHHHHHHHHHHHHHHHHHcccccccccccccEEccccEEEEETTEEEEEcTTccEEEEEcHHHHHHHHHHccHHHHGGGcEEcEEcHHHHHTTcEEccccc################### DISOP:02AL 1-1,474-475| PSIPRED cccEEEEEEccccccHHHHHHHHHHHHHccccEEccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcccEEEccccccccccccccccccccEEEEEEEccccccccEEEEEEEEEccEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEcccccEEEEccccHHcccEEEEEEEEEEccEEEEEEEEccccccHHHHHcHHHHHHcccccccccEEcccc //