[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mic
DDBJ      :mic          transcriptional regulator Mic
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  489/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.55.1
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->406 3bp8B PDBj 0.0 89.5 %
:RPS:PDB   11->406 3bp8A PDBj 3e-54 88.7 %
:RPS:SCOP  11->78 1z05A1  a.4.5.63 * 5e-04 69.1 %
:RPS:SCOP  139->211 1woqA1  c.55.1.10 * 2e-15 23.6 %
:RPS:SCOP  213->406 1z05A2  c.55.1.10 * 9e-29 41.2 %
:HMM:SCOP  11->81 1z05A1 a.4.5.63 * 1e-16 43.7 %
:HMM:SCOP  82->210 1z6rA2 c.55.1.10 * 3.3e-28 31.8 %
:HMM:SCOP  211->406 1z6rA3 c.55.1.10 * 1.6e-46 35.2 %
:RPS:PFM   142->274 PF00480 * ROK 7e-28 43.9 %
:HMM:PFM   90->272 PF00480 * ROK 1.3e-39 35.2 176/179  
:HMM:PFM   20->61 PF01325 * Fe_dep_repress 1.4e-05 16.7 42/60  
:BLT:SWISS 1->406 MLC_ECOLI 0.0 89.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67908.1 GT:GENE mic GT:PRODUCT transcriptional regulator Mic GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1612241..1613461 GB:FROM 1612241 GB:TO 1613461 GB:DIRECTION + GB:GENE mic GB:PRODUCT transcriptional regulator Mic GB:NOTE identified by match to protein family HMM PF00480 GB:PROTEIN_ID ACF67908.1 GB:DB_XREF GI:194407689 GB:GENE:GENE mic LENGTH 406 SQ:AASEQ MVADSQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGSRGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVEECLPLPLTEATPLLERIITHVDRFFTRHQQKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQLRLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADILFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG GT:EXON 1|1-406:0| BL:SWS:NREP 1 BL:SWS:REP 1->406|MLC_ECOLI|0.0|89.4|406/406| SEG 111->126|eeclplplteatplle| BL:PDB:NREP 1 BL:PDB:REP 12->406|3bp8B|0.0|89.5|380/380| RP:PDB:NREP 1 RP:PDB:REP 11->406|3bp8A|3e-54|88.7|381/381| RP:PFM:NREP 1 RP:PFM:REP 142->274|PF00480|7e-28|43.9|132/181|ROK| HM:PFM:NREP 2 HM:PFM:REP 90->272|PF00480|1.3e-39|35.2|176/179|ROK| HM:PFM:REP 20->61|PF01325|1.4e-05|16.7|42/60|Fe_dep_repress| RP:SCP:NREP 3 RP:SCP:REP 11->78|1z05A1|5e-04|69.1|68/71|a.4.5.63| RP:SCP:REP 139->211|1woqA1|2e-15|23.6|72/129|c.55.1.10| RP:SCP:REP 213->406|1z05A2|9e-29|41.2|194/197|c.55.1.10| HM:SCP:REP 11->81|1z05A1|1e-16|43.7|71/0|a.4.5.63|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->210|1z6rA2|3.3e-28|31.8|129/0|c.55.1.10|1/1|Actin-like ATPase domain| HM:SCP:REP 211->406|1z6rA3|1.6e-46|35.2|193/0|c.55.1.10|1/1|Actin-like ATPase domain| OP:NHOMO 1168 OP:NHOMOORG 542 OP:PATTERN --1-1-----------11---------------------------11--------------111---- 243-A1111111111------2---3------1---1376-223277-61115461-61113644658B542333555-11-2-11-1223215-1---11----11313--------------1----1111112-1144111411111111--11---1-111112221------------311--45-312111111211111111343322111222-32133333257122111111122211112112-2-11-2---2211222211111121111322211222333333231122112111111312111322122-23111111131332221232112--322--11--1-511265521111112--------1------------11111111111-11-11--124--733653257621-----1--1111-21--------1--2---------------------------------------------------------1------------1---------------11----1-1------------------------------112121-1-1--11--1---------------------------342------12--------1111----1-1-------------43322324444444444-4444444444444444443444332223333333333333333532444432-444444424444-------------1----2221111----1222--------------------------1111---------22223333322222-----------------1111111---1-21-----------------------------2351133444-12 --------------------------------------------------------------------------------------------------------------3111121111--1132111391-114--11111111-11-111111111------------------------------------1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 406 STR:RPRED 100.0 SQ:SECSTR EEEEEccccHcccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHTTcEEEccccEEEcccccEEcEEEccTTEEEEEEEEcccEEEEEEEETTccEEEEEEEEccccccccHHHHHHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEcccccccccccTTTHHHHTTcccEEEEEHHHHHHHHHHHccTTTTcccEEEEEEcccEEEEEEETTEEccccccccccGGGccccccccccccccccccTTTccHHHHHHHHHTTTTTccccccccccccHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHHTTccEEEccccTTcGGGGHHHHHHHHHccTTHHHHTTc DISOP:02AL 1-12,61-76| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEccccEEEEEEEEcccEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEcccEEEEccccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEccEEEcccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHccHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHHHcccHHHHHHHcc //