[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : minD
DDBJ      :minD         septum site-determining protein MinD
Swiss-Prot:MIND_SHIFL   RecName: Full=Septum site-determining protein minD;AltName: Full=Cell division inhibitor minD;

Homologs  Archaea  21/68 : Bacteria  534/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->228 1g3qA PDBj 2e-19 29.7 %
:RPS:PDB   21->269 2afiP PDBj 9e-26 14.8 %
:RPS:SCOP  21->269 1cp2A  c.37.1.10 * 4e-29 15.4 %
:HMM:SCOP  1->269 1fp6A_ c.37.1.10 * 1.3e-53 33.2 %
:RPS:PFM   21->187 PF01656 * CbiA 1e-05 33.1 %
:HMM:PFM   5->217 PF01656 * CbiA 1.3e-30 26.6 169/194  
:BLT:SWISS 1->270 MIND_SHIFL e-136 97.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67683.1 GT:GENE minD GT:PRODUCT septum site-determining protein MinD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1960623..1961435 GB:FROM 1960623 GB:TO 1961435 GB:DIRECTION + GB:GENE minD GB:PRODUCT septum site-determining protein MinD GB:NOTE identified by match to protein family HMM PF01656; match to protein family HMM TIGR01968 GB:PROTEIN_ID ACF67683.1 GB:DB_XREF GI:194407464 GB:GENE:GENE minD LENGTH 270 SQ:AASEQ MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLFILPASQTRDKDALTREGVAKVLDSLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVNKGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDATADAGKAYADTVDRLLGEERPFRFIEEEKKGFLKRLFGG GT:EXON 1|1-270:0| SW:ID MIND_SHIFL SW:DE RecName: Full=Septum site-determining protein minD;AltName: Full=Cell division inhibitor minD; SW:GN Name=minD; OrderedLocusNames=SF1162, S1248; SW:KW ATP-binding; Cell cycle; Cell division; Cell inner membrane;Cell membrane; Complete proteome; Membrane; Nucleotide-binding;Septation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->270|MIND_SHIFL|e-136|97.4|270/270| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| SEG 6->20|vvtsgkggvgkttss| BL:PDB:NREP 1 BL:PDB:REP 21->228|1g3qA|2e-19|29.7|192/237| RP:PDB:NREP 1 RP:PDB:REP 21->269|2afiP|9e-26|14.8|244/267| RP:PFM:NREP 1 RP:PFM:REP 21->187|PF01656|1e-05|33.1|133/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 5->217|PF01656|1.3e-30|26.6|169/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 21->269|1cp2A|4e-29|15.4|240/269|c.37.1.10| HM:SCP:REP 1->269|1fp6A_|1.3e-53|33.2|256/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 667 OP:NHOMOORG 574 OP:PATTERN -----------------------11---------1212222221--2------12222222------- -----------------------------------------------------1-----------------------------11111------------------------------------------------11111---1111111111111111111111111111111111111111111111-121111111111111111112211111112121111111111----------------------1--1-----11--1111---------------------------------------------------22112222222222222111111122--123111121122111111111--1----1-----11111-------111111111111-1121121111--111111111111-------1-------1111111111111-1------------------------------------111111111111111111111111111111111--111212221111121111---11-11111111-111-12-211---1--1-----11-1------121--11-11111-111111111-121-111111211-21122222222222222222221-1122111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111------111111111---------------1111111111111111111111111111111111111111221111111111122111111111111--11--111111111111----------------------------1111111111--- -----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117111--2122-11-12121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEccTTccHHHHHHHHHHHHHHHTccEEEEEccTTccTTHHHHTcccccHHHHHHHHccTTcccHHHHcEEcGGGcEEEEcccccTTccccTHHHHHHHHHHHHTTccEEEEEEEcccccTTTTHHHHTTcccEEEEEEcccHHHHHHHHHHHHHHHHHTTTcccEEEcEEEEEccccTTHHHHTTccHHHHHHHHTccEEEEEcccHHHHHHHHTTccHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcc DISOP:02AL 251-262| PSIPRED ccEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccccHHHccccccccccHHHHHccccccccEEEEccccccEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcc //