[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : minE
DDBJ      :minE         cell division topological specificity factor MinE
Swiss-Prot:MINE_SALTY   RecName: Full=Cell division topological specificity factor;

Homologs  Archaea  0/68 : Bacteria  273/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.71.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->88 1ev0A PDBj 5e-29 98.3 %
:RPS:SCOP  31->88 1ev0A  d.71.1.1 * 1e-19 98.3 %
:HMM:SCOP  31->88 1ev0A_ d.71.1.1 * 3.4e-17 46.6 %
:RPS:PFM   14->83 PF03776 * MinE 1e-12 61.8 %
:HMM:PFM   14->83 PF03776 * MinE 9.1e-31 56.5 69/70  
:BLT:SWISS 1->88 MINE_SALTY 2e-45 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66871.1 GT:GENE minE GT:PRODUCT cell division topological specificity factor MinE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1961439..1961705 GB:FROM 1961439 GB:TO 1961705 GB:DIRECTION + GB:GENE minE GB:PRODUCT cell division topological specificity factor MinE GB:NOTE identified by match to protein family HMM PF03776; match to protein family HMM TIGR01215 GB:PROTEIN_ID ACF66871.1 GB:DB_XREF GI:194406652 GB:GENE:GENE minE LENGTH 88 SQ:AASEQ MALLDFFLSRKKSTANIAKERLQIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEESK GT:EXON 1|1-88:0| SW:ID MINE_SALTY SW:DE RecName: Full=Cell division topological specificity factor; SW:GN Name=minE; OrderedLocusNames=STM1816; SW:KW Cell cycle; Cell division; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|MINE_SALTY|2e-45|100.0|88/88| GO:SWS:NREP 2 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| BL:PDB:NREP 1 BL:PDB:REP 31->88|1ev0A|5e-29|98.3|58/58| RP:PFM:NREP 1 RP:PFM:REP 14->83|PF03776|1e-12|61.8|68/68|MinE| HM:PFM:NREP 1 HM:PFM:REP 14->83|PF03776|9.1e-31|56.5|69/70|MinE| GO:PFM:NREP 2 GO:PFM GO:0032955|"GO:regulation of barrier septum formation"|PF03776|IPR005527| GO:PFM GO:0051301|"GO:cell division"|PF03776|IPR005527| RP:SCP:NREP 1 RP:SCP:REP 31->88|1ev0A|1e-19|98.3|58/58|d.71.1.1| HM:SCP:REP 31->88|1ev0A_|3.4e-17|46.6|58/58|d.71.1.1|1/1|Cell division protein MinE topological specificity domain| OP:NHOMO 273 OP:NHOMOORG 273 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------11111----------1-----11--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------1-111-------1----------1---1----111---11---1------------1---------------1-----1------------------------------------111111111111111111111111111111111--111111111111111111---11111111111-111----1-1----------------------11--------------------------1111111-1-11111111111111111111111--111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-11------11-111111-------------------------1111111111111111111---------111111111111111--111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 65.9 SQ:SECSTR ##############################cGGGTTccHHHHHHHHHHHHHHHccccGGGEEEEEEEETTTEEEEEEEEccccccccc DISOP:02AL 9-18,83-89| PSIPRED ccHHHHHccccccHHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEccccEEEEEEEEEccHHHccc //