[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : moaA
DDBJ      :moaA         molybdenum cofactor biosynthesis protein A
Swiss-Prot:MOAA_SALHS   RecName: Full=Molybdenum cofactor biosynthesis protein A;

Homologs  Archaea  66/68 : Bacteria  630/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->299 1tv7B PDBj 3e-44 36.1 %
:RPS:PDB   14->287 2a5hA PDBj 9e-29 16.0 %
:RPS:SCOP  4->311 1tv7A  c.1.28.3 * 4e-77 32.2 %
:HMM:SCOP  3->278 1tv8A_ c.1.28.3 * 2e-64 33.1 %
:RPS:PFM   18->159 PF04055 * Radical_SAM 4e-10 35.3 %
:RPS:PFM   188->311 PF06463 * Mob_synth_C 1e-20 38.7 %
:HMM:PFM   186->312 PF06463 * Mob_synth_C 3.9e-38 35.4 127/128  
:HMM:PFM   19->181 PF04055 * Radical_SAM 1.5e-28 24.2 161/166  
:BLT:SWISS 1->329 MOAA_SALHS 0.0 100.0 %
:PROS 20->31|PS01305|MOAA_NIFB_PQQE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68210.1 GT:GENE moaA GT:PRODUCT molybdenum cofactor biosynthesis protein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 918877..919866 GB:FROM 918877 GB:TO 919866 GB:DIRECTION + GB:GENE moaA GB:PRODUCT molybdenum cofactor biosynthesis protein A GB:NOTE identified by match to protein family HMM PF04055; match to protein family HMM PF06463; match to protein family HMM TIGR02666 GB:PROTEIN_ID ACF68210.1 GB:DB_XREF GI:194407991 GB:GENE:GENE moaA LENGTH 329 SQ:AASEQ MASQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPGGVTNNGFLTVDEIRRVTRAFASLGTEKVRLTGGEPSLRRDFTDIIAAVGENDAIRQIAVTTNGYRLARDAASWREAGLTGVNVSVDSLDARQFHAITGQDKFRQVMAGIDAAFDAGFKKVKVNTVLMRDVNHHQLDTFLAWIQPRPIQLRFIELMETGEGSDLFRKHHISGQVLRDELIKRGWIHQLRQRSDGPAQVFCHPDYVGEIGLIMPYEKDFCATCNRLRVSSVGKLHLCLFGDGGVSLRDLLQDDAQQYALEERISDALREKKQTHFLHQSNTGITQNLSYIGG GT:EXON 1|1-329:0| SW:ID MOAA_SALHS SW:DE RecName: Full=Molybdenum cofactor biosynthesis protein A; SW:GN Name=moaA; OrderedLocusNames=SeHA_C0928; SW:KW 4Fe-4S; Complete proteome; GTP-binding; Iron; Iron-sulfur;Metal-binding; Molybdenum cofactor biosynthesis; Nucleotide-binding;S-adenosyl-L-methionine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->329|MOAA_SALHS|0.0|100.0|329/329| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 20->31|PS01305|MOAA_NIFB_PQQE|PDOC01009| BL:PDB:NREP 1 BL:PDB:REP 4->299|1tv7B|3e-44|36.1|291/326| RP:PDB:NREP 1 RP:PDB:REP 14->287|2a5hA|9e-29|16.0|263/400| RP:PFM:NREP 2 RP:PFM:REP 18->159|PF04055|4e-10|35.3|136/164|Radical_SAM| RP:PFM:REP 188->311|PF06463|1e-20|38.7|124/128|Mob_synth_C| HM:PFM:NREP 2 HM:PFM:REP 186->312|PF06463|3.9e-38|35.4|127/128|Mob_synth_C| HM:PFM:REP 19->181|PF04055|1.5e-28|24.2|161/166|Radical_SAM| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF06463|IPR010505| GO:PFM GO:0019008|"GO:molybdopterin synthase complex"|PF06463|IPR010505| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF06463|IPR010505| RP:SCP:NREP 1 RP:SCP:REP 4->311|1tv7A|4e-77|32.2|307/327|c.1.28.3| HM:SCP:REP 3->278|1tv8A_|2e-64|33.1|275/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 1158 OP:NHOMOORG 844 OP:PATTERN 222313111111111113222121112221122-2111111111212123331311111111112-21 111111111111-121144-42--223433322222332312141112111-1111-1--11211121111-------1112211111-------------1-11111-----------------1112211121111111---121111111111111111111111111------------11-11---1-12232332313333331111113322211--111111111111111111111111111111------1---11---------------------------------------------------------11113111111111121---1111--111-111441121-11111-11--2112111-----111111111311111111111111-11211212111-1112111211112112111121221111111111111111113-----------------------------11111-111122222221222122112212232122121-11121-111111111111121132----------113-1222342122221-4142513112222113211111111111-1111111111111111112111-1-12222212222222222222----111------21111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------2121111111111111111111111-11113122222221232222111---------1111111111111111111111111----111111-----------------------------------------12---1---11- ----111-----12111111111111111111111111-111111111112111-1111111-----------1---------------1211111----2-1111-12-213111211-111113131BI4-321111121111-1-1-1111131111-1112212113231111119111112234-111121211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 92.7 SQ:SECSTR ###ccccTTEEcccccEEEEEEEcccccTTcTTcTTTTTTTTccccccHHHHHHHHHHHTcTTccEEEEEEccTTcHHHHHHHHHHHHTcTTccEEEEEccHHHHcGGGccHHHHHHTTccEGGGccEEEEEccccGGGccHHHHHHHHHHHHTTcccEEEEEEccTTTTcHHHHHHHHHHHHTTEEEEEEEcccccTTcGGGcccHHHHHHHHHTTcTTEEEEccccEEEEETTEEEEEcTTccEEETTcccccccTTTTcccccccHTHHHHHTTccccccTTcGGGcccHHTcEEcccccccccc##################### DISOP:02AL 1-2,6-6| PSIPRED cccccHHHccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccHHccccHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHcccccHHHHHHHHHHHcccEEHHccccccEEEEEEccccEEEEEEccccccccccccEEEEEEccEEEEcccccccccHHHHHHccccHHHHHHHHHHHHHcccccccHHHccccccEEcccccc //