[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : moaD
DDBJ      :moaD         molybdopterin converting factor, subunit 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->81 1fm0D PDBj 6e-37 85.2 %
:RPS:PDB   1->80 3biiD PDBj 2e-22 85.0 %
:RPS:SCOP  1->81 1fm0D  d.15.3.1 * 9e-23 85.2 %
:HMM:SCOP  1->81 1fm0D_ d.15.3.1 * 1.6e-25 49.4 %
:RPS:PFM   4->81 PF02597 * ThiS 7e-07 43.2 %
:HMM:PFM   4->81 PF02597 * ThiS 9.7e-25 41.3 75/78  
:BLT:SWISS 1->81 MOAD_ECOLI 2e-36 85.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66147.1 GT:GENE moaD GT:PRODUCT molybdopterin converting factor, subunit 1 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 920881..921126 GB:FROM 920881 GB:TO 921126 GB:DIRECTION + GB:GENE moaD GB:PRODUCT molybdopterin converting factor, subunit 1 GB:NOTE identified by match to protein family HMM PF02597; match to protein family HMM TIGR01682 GB:PROTEIN_ID ACF66147.1 GB:DB_XREF GI:194405928 GB:GENE:GENE moaD LENGTH 81 SQ:AASEQ MIKVLFFAQVRELTGTDALDLPADFSTVESLRQHLTTKSDRWALALEDGKLLAAVNQTLVSFDHPLTAGDEVAFFPPVTGG GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 1->81|MOAD_ECOLI|2e-36|85.2|81/81| BL:PDB:NREP 1 BL:PDB:REP 1->81|1fm0D|6e-37|85.2|81/81| RP:PDB:NREP 1 RP:PDB:REP 1->80|3biiD|2e-22|85.0|80/80| RP:PFM:NREP 1 RP:PFM:REP 4->81|PF02597|7e-07|43.2|74/79|ThiS| HM:PFM:NREP 1 HM:PFM:REP 4->81|PF02597|9.7e-25|41.3|75/78|ThiS| GO:PFM:NREP 1 GO:PFM GO:0006790|"GO:sulfur metabolic process"|PF02597|IPR003749| RP:SCP:NREP 1 RP:SCP:REP 1->81|1fm0D|9e-23|85.2|81/81|d.15.3.1| HM:SCP:REP 1->81|1fm0D_|1.6e-25|49.4|81/0|d.15.3.1|1/1|MoaD/ThiS| OP:NHOMO 204 OP:NHOMOORG 202 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----11----------1--------------11-------11-----11-----11--------------1-1-----------------------------------------11-1-1----11--------1--1111-1--1---11------111-111------------111-----------------------------------------------------------1111111-1-11111111111111111111-------------11111111111111-11-111111111111111111111111111111111111111111111111111--111111111111---1-----------11-111111111111111-----------111111221111111111---------111111111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 100.0 SQ:SECSTR cEEEEEcHHHHHHHcccEEEEccccccHHHHHHHHHTTcHHHHHHHccTTcEEEETTEEccTTccccTTcEEEEEcccccc PSIPRED cEEEEEHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccHHHHHccccEEEEEcHHHcccccEEccccEEEEEcccccc //