[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : moaE
DDBJ      :moaE         molybdopterin converting factor, subunit 2
Swiss-Prot:MOAE_SALTY   RecName: Full=Molybdopterin-converting factor subunit 2;AltName: Full=Molybdopterin synthase subunit 2;         Short=MPT synthase subunit 2;AltName: Full=Molybdenum cofactor biosynthesis protein E;AltName: Full=Molybdopterin-converting factor large subunit;

Homologs  Archaea  36/68 : Bacteria  488/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
d.41.5
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->150 1fm0E PDBj 8e-74 91.5 %
:RPS:SCOP  4->150 1fm0E  d.41.5.1 * 2e-39 91.4 %
:HMM:SCOP  2->150 1fm0E_ d.41.5.1 * 3.7e-57 47.7 %
:RPS:PFM   12->122 PF02391 * MoaE 5e-32 60.9 %
:HMM:PFM   6->121 PF02391 * MoaE 9.1e-42 41.7 115/117  
:BLT:SWISS 1->150 MOAE_SALTY 2e-86 99.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66814.1 GT:GENE moaE GT:PRODUCT molybdopterin converting factor, subunit 2 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 921128..921580 GB:FROM 921128 GB:TO 921580 GB:DIRECTION + GB:GENE moaE GB:PRODUCT molybdopterin converting factor, subunit 2 GB:NOTE identified by match to protein family HMM PF02391 GB:PROTEIN_ID ACF66814.1 GB:DB_XREF GI:194406595 GB:GENE:GENE moaE LENGTH 150 SQ:AASEQ MRETRIVVGPAPFSVGEEYSWLAARDEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGDRWVEARDSDQQLAKRW GT:EXON 1|1-150:0| SW:ID MOAE_SALTY SW:DE RecName: Full=Molybdopterin-converting factor subunit 2;AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2;AltName: Full=Molybdenum cofactor biosynthesis protein E;AltName: Full=Molybdopterin-converting factor large subunit; SW:GN Name=moaE; OrderedLocusNames=STM0806; SW:KW Complete proteome; Molybdenum cofactor biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->150|MOAE_SALTY|2e-86|99.3|150/150| GO:SWS:NREP 1 GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 3->150|1fm0E|8e-74|91.5|141/142| RP:PFM:NREP 1 RP:PFM:REP 12->122|PF02391|5e-32|60.9|110/117|MoaE| HM:PFM:NREP 1 HM:PFM:REP 6->121|PF02391|9.1e-42|41.7|115/117|MoaE| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF02391|IPR003448| RP:SCP:NREP 1 RP:SCP:REP 4->150|1fm0E|2e-39|91.4|140/142|d.41.5.1| HM:SCP:REP 2->150|1fm0E_|3.7e-57|47.7|149/149|d.41.5.1|1/1|Molybdopterin synthase subunit MoaE| OP:NHOMO 693 OP:NHOMOORG 621 OP:PATTERN ---1-111---------------11--11-11------111111111211111-11111111111--- 111-11-----1-11--11-1-----22222-----1------1-----11-1111-1----111--111------------111-1------------------111----------------------1---1111111---111111111111111111111111111------------11111---1-13333332313333331111113322111--11111111111111111111111111111-------1---11-1-----------------------------------------------------------------------------------1------------------1----11111-----111111111111111111111111-11111111111-1111111111111112111111111111111111111111111------------------------------1111-1111122212211111221111111121111111111111111111111111111111----------111------------------------111111---------------------------111112111-1-11111111111111111111----1-1------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------1111111111111111111111111-11111111111221111111111---------111111111111111--11111111----111-11--------------------------------------------------11- ----111-----121---1---1211-11----111111-111-----111-11-11-1111---------------------------11------------11--12----1-111------22-2-311-1122--1--111-11-111-1-11111111211-112-1121-11171--1111-211111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEcccccHHHHHHHHTccTTccEEEEEEEEccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHccEEEEEEEEEcEEEcTTcEEEEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEEETTEEEEccccHHHHHHHHTc DISOP:02AL 1-3,144-147| PSIPRED ccccEEEEEcccccHHHHHHHHHccccccEEEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEccccccHHHHccc //