[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mog
DDBJ      :mog          molybdopterin biosynthesis protein Mog
Swiss-Prot:MOG_SHIFL    RecName: Full=Molybdopterin biosynthesis mog protein;

Homologs  Archaea  20/68 : Bacteria  465/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.57.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->191 1di7A PDBj 2e-93 92.4 %
:RPS:PDB   4->191 1di6A PDBj 4e-14 90.1 %
:RPS:SCOP  4->191 1di6A  c.57.1.1 * 2e-14 90.1 %
:HMM:SCOP  2->191 1di6A_ c.57.1.1 * 1.8e-46 32.1 %
:RPS:PFM   8->140 PF00994 * MoCF_biosynth 9e-10 39.8 %
:HMM:PFM   8->147 PF00994 * MoCF_biosynth 1.6e-31 40.8 130/144  
:BLT:SWISS 1->192 MOG_SHIFL 3e-98 91.7 %
:PROS 69->82|PS01078|MOCF_BIOSYNTHESIS_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67024.1 GT:GENE mog GT:PRODUCT molybdopterin biosynthesis protein Mog GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 8728..9318 GB:FROM 8728 GB:TO 9318 GB:DIRECTION + GB:GENE mog GB:PRODUCT molybdopterin biosynthesis protein Mog GB:NOTE identified by match to protein family HMM PF00994; match to protein family HMM TIGR00177 GB:PROTEIN_ID ACF67024.1 GB:DB_XREF GI:194406805 GB:GENE:GENE mog LENGTH 196 SQ:AASEQ MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRRLIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMRQISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVPYCIQLLDGPYVETAPEVVAAFRPKSARRENMSS GT:EXON 1|1-196:0| SW:ID MOG_SHIFL SW:DE RecName: Full=Molybdopterin biosynthesis mog protein; SW:GN Name=mog; OrderedLocusNames=SF0010, S0009; SW:KW Complete proteome; Molybdenum cofactor biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|MOG_SHIFL|3e-98|91.7|192/195| GO:SWS:NREP 1 GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| PROS 69->82|PS01078|MOCF_BIOSYNTHESIS_1|PDOC00828| BL:PDB:NREP 1 BL:PDB:REP 3->191|1di7A|2e-93|92.4|184/185| RP:PDB:NREP 1 RP:PDB:REP 4->191|1di6A|4e-14|90.1|181/183| RP:PFM:NREP 1 RP:PFM:REP 8->140|PF00994|9e-10|39.8|123/143|MoCF_biosynth| HM:PFM:NREP 1 HM:PFM:REP 8->147|PF00994|1.6e-31|40.8|130/144|MoCF_biosynth| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 1 RP:SCP:REP 4->191|1di6A|2e-14|90.1|181/183|c.57.1.1| HM:SCP:REP 2->191|1di6A_|1.8e-46|32.1|190/190|c.57.1.1|1/1|Molybdenum cofactor biosynthesis proteins| OP:NHOMO 714 OP:NHOMOORG 601 OP:PATTERN 11----1---------1111111---------1-111111----------111--------------- 11111---111---11111-11--111111111111111111111-11-----111-----1-111-1111-------1111-11122-------------1-1--11--------------------------2111111---11-111111-------------1--1-------------1--11---1--11111111111111111----111------1-111-1111---1---------------1---------------------------------------------------------------------11121111111111111---1111--11--111111111111111-11--11----------11-----1-1---11111111111-112121-11-1------1------11-----11111111------------111-------------------------------11---211111111111111111111111111111111-111111111111111111111111----------111----1111111111-111111121----1-1111111111111-11111111111-1--11-21-1-1--2111111211112122112----21-------11111212222222222-222222222222222222222211111222122222222221222222222--111111111111---------------1-11111111111111111111111-----11111221122211111---------11111-------------1-11-------1111-------------------------------------------11---1---11- ----111-----111111-1111212111-1-1-11-111-11111--11----11111------------------------------1211111----1-1111-11-11223--1----1-2-12-3521222---12-13-1-1111113-211---611111211-111111-1611-111-2111111-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 96.4 SQ:SECSTR ##cEEEEEEEEcHHHHTTcccccHHHHHHHHHHHTTTTTTcEEEEEEcccHHHHHHHHHHHHHTccccEEEEEccccccTTccHHHHHHTTccEEcHHHHHHHHHHTccGTcGGGGccccEEEEHTTEEEEEcccHHHHHHHHHEEEcTTccEEEEcGGGGHHHHHHHTTcccccccTTTccccccGGGcc##### DISOP:02AL 1-1,189-189,191-197| PSIPRED ccEEEEEEEEEcccccccccccccHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHccccccHHHHHHHHcccccccEEEEEEEEEEEccEEEEEccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHccHHHHHHccccHHHcccccc //