[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mraY
DDBJ      :mraY         phospho-N-acetylmuramoyl-pentapeptide- transferase
Swiss-Prot:MRAY_SALTI   RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;         EC=2.7.8.13;AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase;

Homologs  Archaea  1/68 : Bacteria  861/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:360 amino acids
:PSIPRED
:RPS:PFM   98->265 PF00953 * Glycos_transf_4 3e-19 51.4 %
:HMM:PFM   99->284 PF00953 * Glycos_transf_4 3.7e-37 39.5 157/159  
:HMM:PFM   68->80 PF10555 * MraY_sig1 1.6e-07 69.2 13/13  
:BLT:SWISS 1->360 MRAY_SALTI 0.0 100.0 %
:PROS 68->80|PS01347|MRAY_1
:PROS 189->200|PS01348|MRAY_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66589.1 GT:GENE mraY GT:PRODUCT phospho-N-acetylmuramoyl-pentapeptide- transferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 141514..142596 GB:FROM 141514 GB:TO 142596 GB:DIRECTION + GB:GENE mraY GB:PRODUCT phospho-N-acetylmuramoyl-pentapeptide- transferase GB:NOTE identified by match to protein family HMM PF00953; match to protein family HMM TIGR00445 GB:PROTEIN_ID ACF66589.1 GB:DB_XREF GI:194406370 GB:GENE:GENE mraY LENGTH 360 SQ:AASEQ MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVPFFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR GT:EXON 1|1-360:0| SW:ID MRAY_SALTI SW:DE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase; EC=2.7.8.13;AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase; SW:GN Name=mraY; OrderedLocusNames=STY0145, t0129; SW:KW Cell cycle; Cell division; Cell inner membrane; Cell membrane;Cell shape; Cell wall biogenesis/degradation; Complete proteome;Membrane; Peptidoglycan synthesis; Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->360|MRAY_SALTI|0.0|100.0|360/360| GO:SWS:NREP 10 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 68->80|PS01347|MRAY_1|PDOC01046| PROS 189->200|PS01348|MRAY_2|PDOC01046| TM:NTM 9 TM:REGION 18->40| TM:REGION 83->105| TM:REGION 133->155| TM:REGION 164->186| TM:REGION 198->220| TM:REGION 234->255| TM:REGION 264->286| TM:REGION 291->312| TM:REGION 335->357| SEG 266->284|gdvgslalggalgiiavll| RP:PFM:NREP 1 RP:PFM:REP 98->265|PF00953|3e-19|51.4|142/162|Glycos_transf_4| HM:PFM:NREP 2 HM:PFM:REP 99->284|PF00953|3.7e-37|39.5|157/159|Glycos_transf_4| HM:PFM:REP 68->80|PF10555|1.6e-07|69.2|13/13|MraY_sig1| OP:NHOMO 905 OP:NHOMOORG 867 OP:PATTERN ----------------------------------------------------------1--------- 1111211111111111111-11111111111111111211111211111111111112111111111111111111111111111111111111111--111111121111111111111111111111111111111111---111111111111111111-1111111111111111111111111111111111111111111111112211111111-21121121112111111111111111111121111111111211111112111-1111111111111111111111111111111111111111111111112111333333313111111111-21111--111111121111111111111-1-1111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111--------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121211111111111111111112111111111111111111111111111111111111111111111111-11111-1-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1211111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------1111111111111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1--1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //