[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mraZ
DDBJ      :mraZ         MraZ protein
Swiss-Prot:MRAZ_SALTY   RecName: Full=Protein mraZ;

Homologs  Archaea  0/68 : Bacteria  515/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->147 1n0fB PDBj 8e-13 30.7 %
:RPS:SCOP  1->141 1n0eA  b.129.1.2 * 3e-44 27.2 %
:HMM:SCOP  1->142 1n0eA_ b.129.1.2 * 5.1e-42 44.8 %
:RPS:PFM   1->69 PF02381 * MraZ 6e-12 49.2 %
:RPS:PFM   81->125 PF02381 * MraZ 7e-08 51.1 %
:HMM:PFM   1->75 PF02381 * MraZ 6.3e-27 38.0 71/72  
:HMM:PFM   77->139 PF02381 * MraZ 9.7e-23 34.9 63/72  
:BLT:SWISS 1->152 MRAZ_SALTY 6e-86 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69144.1 GT:GENE mraZ GT:PRODUCT MraZ protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 135146..135604 GB:FROM 135146 GB:TO 135604 GB:DIRECTION + GB:GENE mraZ GB:PRODUCT MraZ protein GB:NOTE identified by match to protein family HMM PF02381; match to protein family HMM TIGR00242 GB:PROTEIN_ID ACF69144.1 GB:DB_XREF GI:194408925 GB:GENE:GENE mraZ LENGTH 152 SQ:AASEQ MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL GT:EXON 1|1-152:0| SW:ID MRAZ_SALTY SW:DE RecName: Full=Protein mraZ; SW:GN Name=mraZ; OrderedLocusNames=STM0119; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->152|MRAZ_SALTY|6e-86|100.0|152/152| BL:PDB:NREP 1 BL:PDB:REP 1->147|1n0fB|8e-13|30.7|137/139| RP:PFM:NREP 2 RP:PFM:REP 1->69|PF02381|6e-12|49.2|65/69|MraZ| RP:PFM:REP 81->125|PF02381|7e-08|51.1|45/69|MraZ| HM:PFM:NREP 2 HM:PFM:REP 1->75|PF02381|6.3e-27|38.0|71/72|MraZ| HM:PFM:REP 77->139|PF02381|9.7e-23|34.9|63/72|MraZ| RP:SCP:NREP 1 RP:SCP:REP 1->141|1n0eA|3e-44|27.2|136/141|b.129.1.2| HM:SCP:REP 1->142|1n0eA_|5.1e-42|44.8|134/0|b.129.1.2|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 517 OP:NHOMOORG 516 OP:PATTERN -------------------------------------------------------------------- 11-1111111111111111-111111111111111111111111111111111111111-1111111---11111111--111-----111--------1-111111-11---------------11--111-1-11111111111-------------------------------------1111111-1-1---------------111111------11--11111111111111111111111111111-111111111111111111111-----------------------------------------------1111111111111111-------1111111111111111111111111---1---------------------------------------------1112-----1-1-1-----------------------1---1-----------------11-------------------111111111111111111111-11111111111-1111111111111111111111111111111111111-1111111111111111111111111111111-------------------------11111111111111111111111111111111---1111------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111-1111111-11111111----------1111111111111111111---------1--------------11111111111111-1----------------11-----1----1-11111---1---------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 90.1 SQ:SECSTR ccccEEEEcccTTcEEEcccHHHHHc####ccEEcccccccc#ccEEccHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEccTTcEEEccHHHHHHTTccccEEEEEccccEEEEE#####HHHHHHHHHccccHHHHHHTc##### DISOP:02AL 62-67| PSIPRED cccccccccccccccEEEcHHHHHHHHccccccEEEEEcccccEEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccEEEcHHHHHHcccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHcccc //