[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : mrdB
DDBJ      :mrdB         rod shape-determining protein RodA
Swiss-Prot:RODA_SHIFL   RecName: Full=Rod shape-determining protein rodA;

Homologs  Archaea  0/68 : Bacteria  770/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:370 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->364 PF01098 * FTSW_RODA_SPOVE 3e-50 40.1 %
:HMM:PFM   20->364 PF01098 * FTSW_RODA_SPOVE 3.8e-127 45.6 344/359  
:BLT:SWISS 1->370 RODA_SHIFL e-163 98.1 %
:PROS 321->345|PS00428|FTSW_RODA_SPOVE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69222.1 GT:GENE mrdB GT:PRODUCT rod shape-determining protein RodA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(749324..750436) GB:FROM 749324 GB:TO 750436 GB:DIRECTION - GB:GENE mrdB GB:PRODUCT rod shape-determining protein RodA GB:NOTE identified by match to protein family HMM PF01098; match to protein family HMM TIGR02210 GB:PROTEIN_ID ACF69222.1 GB:DB_XREF GI:194409003 GB:GENE:GENE mrdB LENGTH 370 SQ:AASEQ MTDNPNKKTFWDKIHIDPTMLLILLALLVYSALVIWSASGQDIGMMERKIGQIAMGLVVMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLDLGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTAIALVLIFMPTLLVAAQPDLGTSILVALSGLFVLFLSGLSWRLIGVAIVLIAAFIPILWFFLMHDYQRQRVMMLLDPETDPLGAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKMLSKSV GT:EXON 1|1-370:0| SW:ID RODA_SHIFL SW:DE RecName: Full=Rod shape-determining protein rodA; SW:GN Name=mrdB; Synonyms=rodA; OrderedLocusNames=SF0647, S0669; SW:KW Cell inner membrane; Cell membrane; Cell shape; Complete proteome;Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->370|RODA_SHIFL|e-163|98.1|370/370| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 321->345|PS00428|FTSW_RODA_SPOVE|PDOC00352| TM:NTM 8 TM:REGION 16->38| TM:REGION 50->72| TM:REGION 75->97| TM:REGION 146->168| TM:REGION 182->204| TM:REGION 267->289| TM:REGION 299->321| TM:REGION 333->355| SEG 21->35|llillallvysalvi| SEG 165->179|lvalsglfvlflsgl| SEG 267->288|vlaeelglvgilillalyilli| SEG 325->343|vsgilpvvgvplplvsygg| RP:PFM:NREP 1 RP:PFM:REP 55->364|PF01098|3e-50|40.1|309/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 20->364|PF01098|3.8e-127|45.6|344/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1275 OP:NHOMOORG 772 OP:PATTERN -------------------------------------------------------------------- 2221211--------22----1111------1111112221212---1--------------1-1--1111-------3211111212111111111--1111111111222111122-1----21121111111121122---1112122211111122211111122221112111112212--11112223334344445444544434432444233331243333332-222222222222222222121122212121222222-2111-1111111----11-----------111111111111--11111111-2222333333333331222133321312212122233222211222211112-22221111-11---11------11111111111-1111111-1-21111111111-11-11121111111111111111111111121122--------11222222222222211111111112222212222122222222222222222211212222222122111211112221211-------11121221221211122221222222221111211121111111111-111111111111111112222112222122222223222222322221-2111211----22222212222222222-2232222222222122222222222222222222222222222222222222122222222222222221111111112122222222222222222222222221122211112222212122222111111111233322222233222332222222211111121111111-111111111--------------------------11111111-122- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,368-371| PSIPRED ccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHccc //