[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nagA2
DDBJ      :nagA2        N-acetylglucosamine-6-phosphate deacetylase
Swiss-Prot:NAGA_ECOLI   RecName: Full=N-acetylglucosamine-6-phosphate deacetylase;         EC=3.5.1.25;AltName: Full=GlcNAc 6-P deacetylase;

Homologs  Archaea  13/68 : Bacteria  560/915 : Eukaryota  131/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:384 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->380 2p50A PDBj 0.0 92.4 %
:RPS:PDB   1->376 3egjA PDBj 2e-50 61.7 %
:RPS:SCOP  1->73 1ymyA1  b.92.1.5 * 1e-09 61.6 %
:RPS:SCOP  54->350 1ymyA2  c.1.9.10 * 9e-52 93.5 %
:HMM:SCOP  1->53 1yrrA1 b.92.1.5 * 9.1e-20 52.8 %
:HMM:SCOP  54->350 1yrrA2 c.1.9.10 * 1.8e-102 49.5 %
:HMM:SCOP  350->382 1yrrA1 b.92.1.5 * 1.9e-05 57.6 %
:RPS:PFM   316->360 PF01979 * Amidohydro_1 3e-08 51.1 %
:HMM:PFM   50->363 PF01979 * Amidohydro_1 5.8e-42 20.4 289/328  
:BLT:SWISS 1->380 NAGA_ECOLI 0.0 92.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67229.1 GT:GENE nagA2 GT:PRODUCT N-acetylglucosamine-6-phosphate deacetylase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(791332..792486) GB:FROM 791332 GB:TO 792486 GB:DIRECTION - GB:GENE nagA2 GB:PRODUCT N-acetylglucosamine-6-phosphate deacetylase GB:NOTE identified by match to protein family HMM PF01979; match to protein family HMM TIGR00221 GB:PROTEIN_ID ACF67229.1 GB:DB_XREF GI:194407010 GB:GENE:GENE nagA2 LENGTH 384 SQ:AASEQ MYALTQGRIFTGHEILDDHALVVANGLIDRVCPMAELPPGIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNFLPTLITTSDELMKQGIRIMREYLEKHPHQALGLHLEGPWLNLVKKGTHNPDFVRKPDAALVDFLCDNADVITKVTLAPEMVPADVIAKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLFNAMPYITGREPGLAGAVLDEADIYCGVIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVAHCGIALDEVLRMATLYPARAIGVDKHLGSIAPGKVANLTAFTHDFKIIKTIVNGDEVVDLSK GT:EXON 1|1-384:0| SW:ID NAGA_ECOLI SW:DE RecName: Full=N-acetylglucosamine-6-phosphate deacetylase; EC=3.5.1.25;AltName: Full=GlcNAc 6-P deacetylase; SW:GN Name=nagA; OrderedLocusNames=b0677, JW0663; SW:KW 3D-structure; Carbohydrate metabolism; Complete proteome; Hydrolase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->380|NAGA_ECOLI|0.0|92.4|380/382| GO:SWS:NREP 2 GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 1->380|2p50A|0.0|92.4|380/382| RP:PDB:NREP 1 RP:PDB:REP 1->376|3egjA|2e-50|61.7|373/379| RP:PFM:NREP 1 RP:PFM:REP 316->360|PF01979|3e-08|51.1|45/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 50->363|PF01979|5.8e-42|20.4|289/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 2 RP:SCP:REP 1->73|1ymyA1|1e-09|61.6|73/85|b.92.1.5| RP:SCP:REP 54->350|1ymyA2|9e-52|93.5|291/291|c.1.9.10| HM:SCP:REP 1->53|1yrrA1|9.1e-20|52.8|53/0|b.92.1.5|1/2|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 54->350|1yrrA2|1.8e-102|49.5|297/0|c.1.9.10|1/1|Metallo-dependent hydrolases| HM:SCP:REP 350->382|1yrrA1|1.9e-05|57.6|33/0|b.92.1.5|2/2|Composite domain of metallo-dependent hydrolases| OP:NHOMO 836 OP:NHOMOORG 704 OP:PATTERN ----1---1111111111---------------------------------------1---1------ 111-211-111-1-11111-1---11111111-----2111--112111--1123-11--111111111111---111111-1-----2232-3-------1---1-2-4----------------------------------111111111--111111111-111111-111---1-11-1111-1111-1111111221121112111111111111211122222111-11111111111111111112111121-11111--221121111111111111111111111111111111111111111111111111111-111111111212-2--11111-11-311--------11--1111211-12122-------------------11111111111-1111111-11--111111111111------111111111111111111111--1--------------------------------1--1-----111111111111111111111111--1------1---------1-------1----------------------------------------------------------------------1--2111-11-111211111-122211121111--1----------21112111222222222-2222222222222221222111111121211111111111111111111111-12222222222211-------------1-1111111111111111-----------111111111---------111111111-1334222221113322111111111111---1------11111111-----------1-1--111-11-11---11111111111-1 ------1--------2-221211111111111111111111111111211112111111111111----1--1-1------11111---121-11-2111--1211-1--1111111111-1111113-4A1-21111-111111-11--11-11111111-1-11-11111111----------1---2---11---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 384 STR:RPRED 100.0 SQ:SECSTR cEEEEccEEEccccEEccEEEEEETTEEEEEEEGGGccTTccEEEcTTcEEEEcEEEEEEcccTTccTTTGHHcccHHHHHHHHHHHHTTTEEEEEEEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEcccccGGGcTTccTTTcccccHHHHHHHHHTGGGEEEEEEcGGGccHHHHHHHHHTTcEEEEccccccHHHHHHHHHHTccEEccTTcccccccTTccHHHHHHHTcTTcEEEEccccccccHHHHHHHHHHHGGGEEEcccccTTTTccccEEEETTEEEEEETTEEEETTTEEccccccHHHHHHHHHHTTcccHHHHHHTTTHHHHHHHTcTTTcccccTTccccEEEEcTTccEEEEEETTEEEEEEET DISOP:02AL 384-385| PSIPRED cEEEEccEEEccccEEEcEEEEEEccEEEEEEcccccccccEEEEccccEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHccccHHHHccccHHHHHHHHHccccEEEEEEccccccHHHHHHHHHcccEEEEccccccHHHHHHHHHccccEEEEccccccccccccccHHHHHHccccEEEEEEcccEEEcHHHHHHHHHHccccEEEEccccccccccccccccccEEEEEEccEEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccEEEEcccccEEEEEEccEEEEEccc //