[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : narY
DDBJ      :narY         nitrate reductase 2, beta subunit
Swiss-Prot:NARY_ECOLI   RecName: Full=Respiratory nitrate reductase 2 beta chain;         EC=1.7.99.4;

Homologs  Archaea  39/68 : Bacteria  444/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:514 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->505 1siwB PDBj 0.0 80.4 %
:RPS:PDB   178->254 1bc6A PDBj 4e-16 25.3 %
:RPS:SCOP  1->506 1q16B  d.58.1.5 * 5e-39 75.6 %
:HMM:SCOP  1->509 1q16B_ d.58.1.5 * 1.2e-191 44.7 %
:HMM:PFM   10->26 PF00037 * Fer4 2.4e-05 47.1 17/24  
:BLT:SWISS 1->514 NARY_ECOLI 0.0 94.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69166.1 GT:GENE narY GT:PRODUCT nitrate reductase 2, beta subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1713272..1714816 GB:FROM 1713272 GB:TO 1714816 GB:DIRECTION + GB:GENE narY GB:PRODUCT nitrate reductase 2, beta subunit GB:NOTE identified by match to protein family HMM TIGR01660 GB:PROTEIN_ID ACF69166.1 GB:DB_XREF GI:194408947 GB:GENE:GENE narY LENGTH 514 SQ:AASEQ MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTGREGMEYAWFNNVETKPGIGYPKNWEDQQEWQGGWVRDVNGKIRPRLGGKMGVISKIFANPVIPQIDDYYEPFTFDYQHLHNAPESKHQPTARPRSLIDGKRMDKVIWGPNWEELLGGEFEKRARDRNFDNIQKEMYGQFENTFMMYLPRLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEDAASTEHETDLYERQCDVFLNPHDPAVIEEALKQGIPQNVIDAAQRSPVYKMAMDWKLALPLHPEYRTLPMVWYVPPLSPIQSYADAGGLPHNGNILPAVETLRIPVQYLANMLSAGDTGPVIRALKRMMAMRHYMRSQTVEGVTDTRAIDEVGLSVQQVEEMYRYLAIANYEDRFVIPTSHREMARDAFPERNGCGFTFGDGCHGSDTKFNLFNSSRIDAINITEVRDKAEGE GT:EXON 1|1-514:0| SW:ID NARY_ECOLI SW:DE RecName: Full=Respiratory nitrate reductase 2 beta chain; EC=1.7.99.4; SW:GN Name=narY; OrderedLocusNames=b1467, JW1462; SW:KW 3Fe-4S; 4Fe-4S; Cell membrane; Complete proteome;Direct protein sequencing; Electron transport; Iron; Iron-sulfur;Membrane; Metal-binding; Nitrate assimilation; Oxidoreductase; Repeat;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->514|NARY_ECOLI|0.0|94.4|514/514| GO:SWS:NREP 11 GO:SWS GO:0051538|"GO:3 iron, 4 sulfur cluster binding"|3Fe-4S| GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0042128|"GO:nitrate assimilation"|Nitrate assimilation| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 1->505|1siwB|0.0|80.4|504/508| RP:PDB:NREP 1 RP:PDB:REP 178->254|1bc6A|4e-16|25.3|75/77| HM:PFM:NREP 1 HM:PFM:REP 10->26|PF00037|2.4e-05|47.1|17/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->506|1q16B|5e-39|75.6|505/509|d.58.1.5| HM:SCP:REP 1->509|1q16B_|1.2e-191|44.7|508/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 1768 OP:NHOMOORG 487 OP:PATTERN 22-21221344333323-3364463113-112-----111111--------------313----1--- -5711-11111--1-1111-11--1211111-12221-111---11211-----1-----2122112-3----------5bQ334222-----------------1-------------------2243333332322211222-3----------------------------------------1-1----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1--------------------------------------------------------22--1111111-1-12-----------7--11lh1123-378---1----511--1------1---222--1--11111111112---2--1-2-1-------------121-11112-1--2-1111111113----5-------------------------------------111-22112122333333234444132222131--121-21223112112-14---23----------8131624279748444814647666--7696-232-32-1--11-----------161321142-111-----45885-5E999667BA7H6----642------948576-ABBAAA99AA-BAABAAAA9ABAA9AAAA566654219DBCCDDDDDDCBDBCD5787A9AA--333333333333---1---------1112-444434133232114-------1-12-22221-1--11114-------------1222-----3311222------------123---------------------------------------------------1--2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 505 STR:RPRED 98.2 SQ:SECSTR ccEEEEEEEEEETTTcccccHHHHHHHHHHcccTTcTTccccEEEEEcccTTTTTTTcHHHHcccEEEcTTccEEETTccHHHHHTTTTccTTcccHHHHcccEEEcTHHHHHcccccccccccEEETTTccccccccccTTTTGGGcccHHHHTTcGGGTTcccGGEEEcccccccEcccTTTTccccccTTTcTTccEEEEEccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTTccccccccccccTTHHHHccccHHHHHHHHHHHHHHccTTccHHHHHHHHcHHHHHHHHTccccGGGccccTTccGGGGGccccccccccGGGcccccEEEEccccccccccccccccTTccTcccGGGccccHHHHHHHHcTTccHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHTccHHHHHHHHHHHTTccHHHHEEcccccTTTTccHHHHHHHTTcccccccTTccccccTTccccTTccccc######### DISOP:02AL 1-4,416-429,496-515| PSIPRED cccEEEEEEEEEccccccccEEEEEEccccccccccEEEEEEEEEccccccccccccccccccccEEEccccccccccccHHHHHHHHHccccccccccccccccccHHHHHcccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEEEEEcccccccEEEEEccccccccccHHHHHcccccEEEEccccEEEEcHHHHccHHHHHHHcccccEEEcccccEEEEccccHHHHHcccccEEHHHcccccEEEEcccccccHHHHHHHccccccHHHHccccccccccHHHHHHHHHcccccHHHHccccccEEEEEEcccccccccccccccccEEEEccccHHHHHHHHccccccccccccHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHccccccccEEcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc //