[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nudB
DDBJ      :nudB         dATP pyrophosphohydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->148 2o1cA PDBj 5e-77 89.8 %
:RPS:PDB   5->145 3dkuF PDBj 4e-15 23.6 %
:RPS:SCOP  6->145 1f3yA  d.113.1.1 * 9e-17 22.3 %
:HMM:SCOP  8->147 2a6tA2 d.113.1.7 * 2.7e-23 24.2 %
:RPS:PFM   8->70 PF00293 * NUDIX 1e-05 37.1 %
:HMM:PFM   9->147 PF00293 * NUDIX 3.8e-25 25.4 126/135  
:BLT:SWISS 1->150 NUDB_SHIFL 1e-77 89.3 %
:PROS 41->62|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67191.1 GT:GENE nudB GT:PRODUCT dATP pyrophosphohydrolase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2042896..2043348) GB:FROM 2042896 GB:TO 2043348 GB:DIRECTION - GB:GENE nudB GB:PRODUCT dATP pyrophosphohydrolase GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF67191.1 GB:DB_XREF GI:194406972 GB:GENE:GENE nudB LENGTH 150 SQ:AASEQ MKDKVYKRPVSVLVVIFAQDTKRVLMLQRRDDPDFWQSVTGSIEEGETALQAAVREVKEEVTIDVAAEQLTLIDCQRTVEFEIFSHLRHRYAPGVMHNTEFWFCLALPHERQVIFTEHLTYQWLDAPDAAALTKSWSNRQAIEEFVINVA GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->150|NUDB_SHIFL|1e-77|89.3|150/150| PROS 41->62|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 2->148|2o1cA|5e-77|89.8|147/147| RP:PDB:NREP 1 RP:PDB:REP 5->145|3dkuF|4e-15|23.6|127/149| RP:PFM:NREP 1 RP:PFM:REP 8->70|PF00293|1e-05|37.1|62/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 9->147|PF00293|3.8e-25|25.4|126/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 6->145|1f3yA|9e-17|22.3|139/165|d.113.1.1| HM:SCP:REP 8->147|2a6tA2|2.7e-23|24.2|124/0|d.113.1.7|1/1|Nudix| OP:NHOMO 163 OP:NHOMOORG 163 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111111-11111111111111111111-1--------------------------------------------------------------1----1---------------------------1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111------------------111111111111111------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 98.7 SQ:SECSTR HHHcccccEEEEEEEEEETTGTEEEEEEEEccccEEEccEEEccTTccHHHHHHHHHHHHHcccEEccccEEEEEEEEEcTTccEEEEEEEEEEcccEEEEEccccccccTTTcccTccEEEEEcHHHHHTccccTHHHHHHHHHHEE## DISOP:02AL 1-5| PSIPRED ccccccccccEEEEEEEEccccEEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEcccEEEEccccEEcccccccEEEEEEEEEEEEcccccccccHHcEEEEccHHHHHHHcccHHHHHHHHHHHHHcc //