[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoA
DDBJ      :nuoA         NADH-quinone oxidoreductase, A subunit
Swiss-Prot:NUOA_SALTY   RecName: Full=NADH-quinone oxidoreductase subunit A;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit A;AltName: Full=NDH-1 subunit A;AltName: Full=NUO1;

Homologs  Archaea  8/68 : Bacteria  490/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->125 PF00507 * Oxidored_q4 3e-15 34.3 %
:HMM:PFM   26->125 PF00507 * Oxidored_q4 8.2e-29 38.0 100/102  
:BLT:SWISS 1->147 NUOA_SALTY 1e-82 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65975.1 GT:GENE nuoA GT:PRODUCT NADH-quinone oxidoreductase, A subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2483812..2484255) GB:FROM 2483812 GB:TO 2484255 GB:DIRECTION - GB:GENE nuoA GB:PRODUCT NADH-quinone oxidoreductase, A subunit GB:NOTE identified by match to protein family HMM PF00507 GB:PROTEIN_ID ACF65975.1 GB:DB_XREF GI:194405756 GB:GENE:GENE nuoA LENGTH 147 SQ:AASEQ MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR GT:EXON 1|1-147:0| SW:ID NUOA_SALTY SW:DE RecName: Full=NADH-quinone oxidoreductase subunit A; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit A;AltName: Full=NDH-1 subunit A;AltName: Full=NUO1; SW:GN Name=nuoA; OrderedLocusNames=STM2328; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|NUOA_SALTY|1e-82|100.0|147/147| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 14->36| TM:REGION 68->90| TM:REGION 101->123| RP:PFM:NREP 1 RP:PFM:REP 18->125|PF00507|3e-15|34.3|108/108|Oxidored_q4| HM:PFM:NREP 1 HM:PFM:REP 26->125|PF00507|8.2e-29|38.0|100/102|Oxidored_q4| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00507|IPR000440| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00507|IPR000440| OP:NHOMO 547 OP:NHOMOORG 506 OP:PATTERN -------------------------11-1--1-----------------1111--------------- 122-1----------1111-1---111111111-------1----1--------------1-111-1221------------1---------1------1-11--21111--------------11-11111112122211111211111--111111--1-111----111111---1-11----------1-111111111111111------1-1111----------11----------------------------------------------------------------------------------------------1-----------------------1--1-1111----11-------11-111111111111111112222211111111111-111111111111111122211111111111111111111--------222-111-1111111111111111111111111111111111-11111111111111111111111111111111111111111--1111111111111211111111112111--------1------222122213112111-21-111------1-1111111-1-1111111---------------------1----11--2-1111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111--1----------------11111111111-22221-1111111-111---------1--------------11111111111111111-----11----------------------------------------------1-1 ---------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11-------1-2-2--2--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,125-148| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHcHHcccc //