[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoB
DDBJ      :nuoB         NADH-quinone oxidoreductase, B subunit
Swiss-Prot:NUOB_SALTY   RecName: Full=NADH-quinone oxidoreductase subunit B;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B;

Homologs  Archaea  67/68 : Bacteria  604/915 : Eukaryota  141/199 : Viruses  0/175   --->[See Alignment]
e.19.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->176 3i9v6 PDBj 2e-28 46.0 %
:RPS:PDB   50->219 1e3dA PDBj 6e-33 16.5 %
:RPS:SCOP  35->185 2fug61  e.19.1.2 * 7e-51 51.5 %
:HMM:SCOP  33->193 2fug61 e.19.1.2 * 2e-62 50.3 %
:RPS:PFM   64->172 PF01058 * Oxidored_q6 6e-20 46.3 %
:HMM:PFM   64->170 PF01058 * Oxidored_q6 3.3e-25 32.1 106/131  
:BLT:SWISS 1->220 NUOB_SALTY e-131 100.0 %
:PROS 144->160|PS01150|COMPLEX1_20K

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67677.1 GT:GENE nuoB GT:PRODUCT NADH-quinone oxidoreductase, B subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2483134..2483796) GB:FROM 2483134 GB:TO 2483796 GB:DIRECTION - GB:GENE nuoB GB:PRODUCT NADH-quinone oxidoreductase, B subunit GB:NOTE identified by match to protein family HMM PF01058; match to protein family HMM TIGR01957 GB:PROTEIN_ID ACF67677.1 GB:DB_XREF GI:194407458 GB:GENE:GENE nuoB LENGTH 220 SQ:AASEQ MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI GT:EXON 1|1-220:0| SW:ID NUOB_SALTY SW:DE RecName: Full=NADH-quinone oxidoreductase subunit B; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B; SW:GN Name=nuoB; OrderedLocusNames=STM2327; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->220|NUOB_SALTY|e-131|100.0|220/220| GO:SWS:NREP 10 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 144->160|PS01150|COMPLEX1_20K|PDOC00858| BL:PDB:NREP 1 BL:PDB:REP 35->176|3i9v6|2e-28|46.0|126/145| RP:PDB:NREP 1 RP:PDB:REP 50->219|1e3dA|6e-33|16.5|170/262| RP:PFM:NREP 1 RP:PFM:REP 64->172|PF01058|6e-20|46.3|108/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 64->170|PF01058|3.3e-25|32.1|106/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 1 RP:SCP:REP 35->185|2fug61|7e-51|51.5|134/144|e.19.1.2| HM:SCP:REP 33->193|2fug61|2e-62|50.3|161/0|e.19.1.2|1/1|HydA/Nqo6-like| OP:NHOMO 1232 OP:NHOMOORG 812 OP:PATTERN 11313121222222213112222121111211212223222222132411233132232431121-11 22212---------12111-11--11111111111-11111111-1--1-----------22212112221--------21111111211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533-12231111111111111111111111111111111111-111111111111222211123233221131122111111111111221111111112111111111122211-1-2-1-442223-433132418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------121111-11-251 ----111-211-1111121112222312212122221222122211-111223211222111111----1--111------11111---12111111111111112-1-32211111-------22-2-4J1-321----3--2------1--1--1-111-1111232121121111-----1123-41131134231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 99.1 SQ:SECSTR HHHHHHccHHHHHHHHHHHHHHHcccccc#TTTHHTccTTcHHHHHHHTccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEEEHTcccccEEEEEccEEcTGGGHHHHHHHHGGGccEEEEEcHHHHHcGGGcEEcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTccccccTTccHHHHcccHHHHcTTHHHHHTTccccccccHHHHT# DISOP:02AL 1-3,195-207,217-221| PSIPRED cccEEEEcccccccccccccccccccccccccccccEEEEEHHHHHHHHHHcccEEEEccccHHHHHHHHHccccccHHHHcEEEEcccHHHccEEEEEcccccHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHccEEEEEccccccc //