[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoE
DDBJ      :nuoE         NADH-quinone oxidoreductase, E subunit
Swiss-Prot:NUOE_SALTY   RecName: Full=NADH-quinone oxidoreductase subunit E;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit E;AltName: Full=NDH-1 subunit E;

Homologs  Archaea  6/68 : Bacteria  539/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->150 3iam2 PDBj 9e-18 32.0 %
:RPS:PDB   82->165 2auvA PDBj 5e-24 29.8 %
:RPS:SCOP  14->162 2fug21  c.47.1.21 * 6e-35 29.5 %
:HMM:SCOP  14->166 2fug21 c.47.1.21 * 7.7e-50 39.2 %
:RPS:PFM   29->165 PF01257 * Complex1_24kDa 2e-33 46.0 %
:HMM:PFM   24->166 PF01257 * Complex1_24kDa 8.5e-53 40.6 143/145  
:BLT:SWISS 1->166 NUOE_SALTY 7e-98 100.0 %
:PROS 123->141|PS01099|COMPLEX1_24K

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68005.1 GT:GENE nuoE GT:PRODUCT NADH-quinone oxidoreductase, E subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2480742..2481242) GB:FROM 2480742 GB:TO 2481242 GB:DIRECTION - GB:GENE nuoE GB:PRODUCT NADH-quinone oxidoreductase, E subunit GB:NOTE identified by match to protein family HMM PF01257; match to protein family HMM TIGR01958 GB:PROTEIN_ID ACF68005.1 GB:DB_XREF GI:194407786 GB:GENE:GENE nuoE LENGTH 166 SQ:AASEQ MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK GT:EXON 1|1-166:0| SW:ID NUOE_SALTY SW:DE RecName: Full=NADH-quinone oxidoreductase subunit E; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit E;AltName: Full=NDH-1 subunit E; SW:GN Name=nuoE; OrderedLocusNames=STM2325; SW:KW 2Fe-2S; Complete proteome; Iron; Iron-sulfur; Metal-binding; NAD;Oxidoreductase; Quinone; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->166|NUOE_SALTY|7e-98|100.0|166/166| GO:SWS:NREP 6 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 123->141|PS01099|COMPLEX1_24K|PDOC00843| BL:PDB:NREP 1 BL:PDB:REP 26->150|3iam2|9e-18|32.0|125/179| RP:PDB:NREP 1 RP:PDB:REP 82->165|2auvA|5e-24|29.8|84/85| RP:PFM:NREP 1 RP:PFM:REP 29->165|PF01257|2e-33|46.0|137/142|Complex1_24kDa| HM:PFM:NREP 1 HM:PFM:REP 24->166|PF01257|8.5e-53|40.6|143/145|Complex1_24kDa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01257|IPR002023| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01257|IPR002023| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01257|IPR002023| RP:SCP:NREP 1 RP:SCP:REP 14->162|2fug21|6e-35|29.5|149/178|c.47.1.21| HM:SCP:REP 14->166|2fug21|7.7e-50|39.2|153/0|c.47.1.21|1/1|Thioredoxin-like| OP:NHOMO 988 OP:NHOMOORG 715 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11211---------11111-11--12111111211111111111-1--1-----------11111111111----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222444111111111--11------11--11--------------1111133---------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111232221123333311111111111-22222222121122223332223322111222333321111111111322-22111111111111111111111111111111111221-22212222122222221111222222112223311111321112112222221222111111111113122131-2-1--3-----343243265111111641--1---------------------11112---2-----------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111113-111---------------11111111111-1111221122222-1111111111111--------------11111111111111111-111111------------------------------------3223333233221 ----111-211-11111111111111-111111111111111111111111111111111-1111----1--111------11111---12111111111111112-111211111111111111113-3A1-3121-111113111-111111-11111111111221251111111171111121321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 84.3 SQ:SECSTR #########################TccTTcGGGGHHHHHHHHHHHHccccHHHHHHHHHHHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccccccccccccccccccccTTccccEEGGGccccccccHHHHHHHHc# DISOP:02AL 1-6| PSIPRED cccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHccccccccccEEEEEEccHHHHHccHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccEEEEccEEEccccHHHHHHHHHHHc //