[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoH
DDBJ      :nuoH         NADH-quinone oxidoreductase, H subunit
Swiss-Prot:NUOH_SALTY   RecName: Full=NADH-quinone oxidoreductase subunit H;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit H;AltName: Full=NDH-1 subunit H;

Homologs  Archaea  52/68 : Bacteria  595/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
b.71.1
:325 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  155->238 1bf2A2  b.71.1.1 * 3e-12 8.3 %
:RPS:PFM   30->316 PF00146 * NADHdh 7e-67 51.2 %
:HMM:PFM   15->320 PF00146 * NADHdh 5.5e-127 45.8 306/311  
:BLT:SWISS 1->325 NUOH_SALTY 0.0 100.0 %
:PROS 56->71|PS00667|COMPLEX1_ND1_1
:PROS 211->224|PS00668|COMPLEX1_ND1_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68655.1 GT:GENE nuoH GT:PRODUCT NADH-quinone oxidoreductase, H subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2475677..2476654) GB:FROM 2475677 GB:TO 2476654 GB:DIRECTION - GB:GENE nuoH GB:PRODUCT NADH-quinone oxidoreductase, H subunit GB:NOTE identified by match to protein family HMM PF00146 GB:PROTEIN_ID ACF68655.1 GB:DB_XREF GI:194408436 GB:GENE:GENE nuoH LENGTH 325 SQ:AASEQ MSWITPDLIEILLSILKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSPNWVVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTVSYEVFLGLSLMGVVAQAGSFNMTDIVNNQAHLWNVIPQFFGFVTFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVGEYIGIVTVSALMVTLFFGGWHGPFLPPFVWFALKTAFFMMMFILIRASLPRPRYDQVMSFGWKVCLPLTLINLLVTAAVILWQAQ GT:EXON 1|1-325:0| SW:ID NUOH_SALTY SW:DE RecName: Full=NADH-quinone oxidoreductase subunit H; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit H;AltName: Full=NDH-1 subunit H; SW:GN Name=nuoH; OrderedLocusNames=STM2322; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->325|NUOH_SALTY|0.0|100.0|325/325| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 56->71|PS00667|COMPLEX1_ND1_1|PDOC00570| PROS 211->224|PS00668|COMPLEX1_ND1_2|PDOC00570| TM:NTM 8 TM:REGION 7->29| TM:REGION 79->101| TM:REGION 112->134| TM:REGION 157->179| TM:REGION 187->209| TM:REGION 234->256| TM:REGION 266->288| TM:REGION 300->322| SEG 11->26|illsilkavvillvvv| RP:PFM:NREP 1 RP:PFM:REP 30->316|PF00146|7e-67|51.2|287/306|NADHdh| HM:PFM:NREP 1 HM:PFM:REP 15->320|PF00146|5.5e-127|45.8|306/311|NADHdh| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00146|IPR001694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00146|IPR001694| RP:SCP:NREP 1 RP:SCP:REP 155->238|1bf2A2|3e-12|8.3|84/113|b.71.1.1| OP:NHOMO 860 OP:NHOMOORG 693 OP:PATTERN 11111111111111111112222111111211-------------1-111111-31111121111-11 22212---------11111-11--11111111112111111111-1--1-----1-----32111112221-----------23211211111---1--1-11--22211--------------1111111111212222211121111111111111111111111111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------1------------2--1-1111----21---11--23-111111111111111112322211111111111-11111121111111112221112211111111222211111111111222-11131111112111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---222222-222122217222212-2121111111111111111111231211111---------------------1----11--311111111121111212222222222-2222222222222222222222111112222222222222222122222221-11111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111------------------------------------12-111-11-121 ---------------------------1---11-11-------1---1------231-----1-1----------------------------1---11----1-1------11111-----1-1--1-12--11-----1--21--------1-1------12--12--1-11-1----------1-8-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //