[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoI
DDBJ      :nuoI         NADH-quinone oxidoreductase, I subunit
Swiss-Prot:NUOI_SALTY   RecName: Full=NADH-quinone oxidoreductase subunit I;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit I;AltName: Full=NDH-1 subunit I;

Homologs  Archaea  47/68 : Bacteria  583/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->147 2fug9 PDBj 9e-33 53.9 %
:RPS:PDB   11->149 1d0cA PDBj 7e-15 11.7 %
:RPS:SCOP  33->155 2fug91  d.58.1.5 * 4e-26 51.2 %
:HMM:SCOP  33->160 2fug91 d.58.1.5 * 8.5e-34 32.0 %
:HMM:PFM   57->76 PF00037 * Fer4 9e-08 50.0 20/24  
:HMM:PFM   93->115 PF00037 * Fer4 8.9e-12 47.8 23/24  
:BLT:SWISS 1->180 NUOI_SALTY e-108 100.0 %
:PROS 60->71|PS00198|4FE4S_FER_1
:PROS 99->110|PS00198|4FE4S_FER_1
:REPEAT 2|59->77|98->116

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70318.1 GT:GENE nuoI GT:PRODUCT NADH-quinone oxidoreductase, I subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2475120..2475662) GB:FROM 2475120 GB:TO 2475662 GB:DIRECTION - GB:GENE nuoI GB:PRODUCT NADH-quinone oxidoreductase, I subunit GB:NOTE identified by match to protein family HMM PF00037; match to protein family HMM TIGR01971 GB:PROTEIN_ID ACF70318.1 GB:DB_XREF GI:194410099 GB:GENE:GENE nuoI LENGTH 180 SQ:AASEQ MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP GT:EXON 1|1-180:0| SW:ID NUOI_SALTY SW:DE RecName: Full=NADH-quinone oxidoreductase subunit I; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit I;AltName: Full=NDH-1 subunit I; SW:GN Name=nuoI; OrderedLocusNames=STM2321; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Repeat; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|NUOI_SALTY|e-108|100.0|180/180| GO:SWS:NREP 9 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 60->71|PS00198|4FE4S_FER_1|PDOC00176| PROS 99->110|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|59->77|98->116| BL:PDB:NREP 1 BL:PDB:REP 33->147|2fug9|9e-33|53.9|115/154| RP:PDB:NREP 1 RP:PDB:REP 11->149|1d0cA|7e-15|11.7|137/416| HM:PFM:NREP 2 HM:PFM:REP 57->76|PF00037|9e-08|50.0|20/24|Fer4| HM:PFM:REP 93->115|PF00037|8.9e-12|47.8|23/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 33->155|2fug91|4e-26|51.2|123/154|d.58.1.5| HM:SCP:REP 33->160|2fug91|8.5e-34|32.0|128/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 996 OP:NHOMOORG 784 OP:PATTERN 111121111111111121-3213-11111211----------------11111-11121221111--1 22212---------11211-11--11111111111111111111-1--1-----------22112112221--------1--1222221111----1--1-11--22211--------------111111111121222221112111111111111111111111111-111111111111111111--1-1-111111111111111------1-1111----------11----------------------------------------------------------------------------------------------1--------------------1--2--1-1111----22--1----23-111111111111111112422211111111111-11111111111111112221112211111111222211111111111222-11121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111-1-2---211--1-332122315223212-2121211111111111111111211111221---------------------1----11--211111111122222212222222223-2323222323222332332222211122222222222222222233211231-21111111111111111111111111--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111111-111111----------------------------------------------121 ----111-----1111111-1111111111111111111111111111111111-1111111111----1--111------11111---1211111111111-112-11-215232-111-11-11111171--121-1-31112111--1--111111--11111111-1111-1111G11-1122241211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 77.2 SQ:SECSTR ##########ccccHHHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHTTGGGTTccEEEEcTTcccHHHHHHHHHHHHHHHHHHGGGccccEEEEcccccTTccccEEcccccccccEEEcTTcc############################### DISOP:02AL 158-174| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccccccccccHHHHcccccEEEEccccccccccccEEEEcHHHccccccHHHHcccccEEEEcccccccccHHHHHccHHHHHHcccccccccccHHHccccccccccccccccccccccccccc //