[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoJ
DDBJ      :nuoJ         NADH-quinone oxidoreductase, J subunit
Swiss-Prot:NUOJ_SHIFL   RecName: Full=NADH-quinone oxidoreductase subunit J;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit J;AltName: Full=NDH-1 subunit J;

Homologs  Archaea  0/68 : Bacteria  180/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->156 PF00499 * Oxidored_q3 2.5e-23 31.6 136/144  
:BLT:SWISS 1->184 NUOJ_SHIFL 3e-82 90.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70030.1 GT:GENE nuoJ GT:PRODUCT NADH-quinone oxidoreductase, J subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2474555..2475109) GB:FROM 2474555 GB:TO 2475109 GB:DIRECTION - GB:GENE nuoJ GB:PRODUCT NADH-quinone oxidoreductase, J subunit GB:NOTE identified by match to protein family HMM PF00499 GB:PROTEIN_ID ACF70030.1 GB:DB_XREF GI:194409811 GB:GENE:GENE nuoJ LENGTH 184 SQ:AASEQ MEFAFYICGLIAILATLRVITHTNPVHALLYLVISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAVLSAIMLAVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRADDRAKRKTEERA GT:EXON 1|1-184:0| SW:ID NUOJ_SHIFL SW:DE RecName: Full=NADH-quinone oxidoreductase subunit J; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit J;AltName: Full=NDH-1 subunit J; SW:GN Name=nuoJ; OrderedLocusNames=SF2356, S2491; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Ubiquinone. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->184|NUOJ_SHIFL|3e-82|90.2|184/184| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 56->78| TM:REGION 94->116| TM:REGION 131->153| SEG 64->74|mvlfvfvvmml| HM:PFM:NREP 1 HM:PFM:REP 13->156|PF00499|2.5e-23|31.6|136/144|Oxidored_q3| OP:NHOMO 182 OP:NHOMOORG 180 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1---------------11111-----------1-1---211--------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------1-11--1-12--1------------------------------------------1-1111---11111111111---1-----------------------------------------------------------------1-1------------------1----------------1------------------1-1--11--------------1------1111-1111-------111---------------------1----11--1---11-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111----------1--1----------------11111111111-1111111111111-111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 163-185| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHcc //