[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoK
DDBJ      :nuoK         NADH-quinone oxidoreductase, K subunit
Swiss-Prot:NUOK_SHIFL   RecName: Full=NADH-quinone oxidoreductase subunit K;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit K;AltName: Full=NDH-1 subunit K;

Homologs  Archaea  0/68 : Bacteria  129/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:HMM:PFM   8->99 PF00420 * Oxidored_q2 6.1e-26 39.1 92/95  
:BLT:SWISS 1->100 NUOK_SHIFL 2e-31 99.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68206.1 GT:GENE nuoK GT:PRODUCT NADH-quinone oxidoreductase, K subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2474256..2474558) GB:FROM 2474256 GB:TO 2474558 GB:DIRECTION - GB:GENE nuoK GB:PRODUCT NADH-quinone oxidoreductase, K subunit GB:NOTE identified by match to protein family HMM PF00420 GB:PROTEIN_ID ACF68206.1 GB:DB_XREF GI:194407987 GB:GENE:GENE nuoK LENGTH 100 SQ:AASEQ MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG GT:EXON 1|1-100:0| SW:ID NUOK_SHIFL SW:DE RecName: Full=NADH-quinone oxidoreductase subunit K; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit K;AltName: Full=NDH-1 subunit K; SW:GN Name=nuoK; OrderedLocusNames=SF2355, S2490; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Ubiquinone. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|NUOK_SHIFL|2e-31|99.0|100/100| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 3->24| TM:REGION 30->51| TM:REGION 60->82| SEG 63->91|ilaislaaaeasiglalllqlhrrrqnln| HM:PFM:NREP 1 HM:PFM:REP 8->99|PF00420|6.1e-26|39.1|92/95|Oxidored_q2| OP:NHOMO 129 OP:NHOMOORG 129 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------1-1-----------------------------------------111---------------------1-----1--1---11-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111----------1--1----------------11111111111-1111111111111-111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcc //