[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : nuoN
DDBJ      :nuoN         NADH-quinone oxidoreductase, N subunit
Swiss-Prot:NUON_SALTI   RecName: Full=NADH-quinone oxidoreductase subunit N;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit N;AltName: Full=NDH-1 subunit N;

Homologs  Archaea  63/68 : Bacteria  682/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   224->398 2c1wA PDBj 3e-18 8.4 %
:RPS:PFM   133->399 PF00361 * Oxidored_q1 8e-21 33.5 %
:HMM:PFM   122->400 PF00361 * Oxidored_q1 1.1e-74 39.2 268/270  
:BLT:SWISS 1->485 NUON_SALTI 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66053.1 GT:GENE nuoN GT:PRODUCT NADH-quinone oxidoreductase, N subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2469348..2470805) GB:FROM 2469348 GB:TO 2470805 GB:DIRECTION - GB:GENE nuoN GB:PRODUCT NADH-quinone oxidoreductase, N subunit GB:NOTE identified by match to protein family HMM PF00361; match to protein family HMM TIGR01770 GB:PROTEIN_ID ACF66053.1 GB:DB_XREF GI:194405834 GB:GENE:GENE nuoN LENGTH 485 SQ:AASEQ MTITPQHLIALLPLLIVGLTVVVVMLSIAWRRNHFLNATLSVIGLNAALVSLWFVGQAGAMDVTPLMRVDGFAMLYTGLVLLASLATCTFAYPWLEGYNDNQEEFYLLVLIASLGGILLANANHLAALFLGIELISLPLFGLIGYAFRQKRSLEASIKYTILSAAASSFLLFGMALVYAQSGNLSFEALGKSLGDGMLHEPLLLAGFGLMIVGLGFKLSLVPFHLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYAPVGDSEAVRVVLGIIAFASIIFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQSGEMSMEAVGVYLAGYLFSSLGAFGVVSLMSSPFRGPDADSLYSYRGLFWHRPVLAAVMTVMMLSLAGIPMTLGFIGKFYVLAVGVQASLWWLVAAVVVGSAIGLYYYLRVAVSLYLHAPQQPGRDAPTNWQYSAGGIVVLISALLVLVLGVWPQPLISLVQLATPLM GT:EXON 1|1-485:0| SW:ID NUON_SALTI SW:DE RecName: Full=NADH-quinone oxidoreductase subunit N; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit N;AltName: Full=NDH-1 subunit N; SW:GN Name=nuoN; OrderedLocusNames=STY2546, t0548; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->485|NUON_SALTI|0.0|100.0|485/485| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 13 TM:REGION 5->27| TM:REGION 35->57| TM:REGION 69->91| TM:REGION 115->137| TM:REGION 157->178| TM:REGION 201->223| TM:REGION 237->259| TM:REGION 269->291| TM:REGION 303->325| TM:REGION 329->350| TM:REGION 371->393| TM:REGION 412->434| TM:REGION 456->478| SEG 8->28|liallpllivgltvvvvmlsi| SEG 114->131|lggillananhlaalflg| SEG 405->419|aslwwlvaavvvgsa| SEG 453->469|ggivvlisallvlvlgv| RP:PDB:NREP 1 RP:PDB:REP 224->398|2c1wA|3e-18|8.4|166/273| RP:PFM:NREP 1 RP:PFM:REP 133->399|PF00361|8e-21|33.5|254/268|Oxidored_q1| HM:PFM:NREP 1 HM:PFM:REP 122->400|PF00361|1.1e-74|39.2|268/270|Oxidored_q1| GO:PFM:NREP 3 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00361|IPR001750| GO:PFM GO:0042773|"GO:ATP synthesis coupled electron transport"|PF00361|IPR001750| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00361|IPR001750| OP:NHOMO 2732 OP:NHOMOORG 782 OP:PATTERN 2241322111211222612222225335446311111-111113-1-324624-63274A54342-22 76725313222-1134333-33--243333323353453333331424622-223111--24432435694--------3--66833433333---3--3-221-65652--------------3533535533656667755474886688677665555558966887634443334334333322--2-52333333333333333422222333535442222222233-2222222222222243321-----------------------------------------------------------------------4--3----------2--------3---5--226653--1344--311--6A1333323244334345546965522222222223-34334364324334466895449834445445555532333333333855-44795555555555442122323233222555532322-34444433333333333346444434338446533333333443344244543432333333333345536325-524-454115-66745583I554537-6354533333333333233333543744333-3-11--2------32-----333-462--B65423133333453335553533334-5555533554535455555333433343333333333333333344455553-43333333333333354444333336112-----2----------555555533321444422224222253233333333333----11111-----44444444443333334-333333------------------------------------141222-2315B2 ---------------------------21--11121-------2---2------242-------2----------------------------1---33------2------1--11-----2-31--------1-----1--11--------1--------11----1----2-1----------2-D-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 36.5 SQ:SECSTR ####################################################################################################################################################################################################################HHHHHHHHHHHcccccccccccccccEEEEcHHHHTTTcTHHHHHHHHHHH#########HHcccccccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHccccccccccccHHHHHTTccccccccccccccHHHHHHHHHTTcEEEEEEccccccccccTTccE####################################################################################### DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //